DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and Fbxl13

DIOPT Version :8

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001096825.2 Gene:Fbxl13 / 100125363 RGDID:1642425 Length:634 Species:Rattus norvegicus

Alignment Length:428 Identity:85/429 (20%)
Similarity:158/429 (37%) Gaps:125/429 (29%)


  Fly    10 LDPSSLLFIFKLLSLEDQLHLARCCRIFRDAFLRLHRHDFQDVVD----KDMS----IRTLEDWR 66
            |...:::.||..|:.:|   |..|.::.|.....:.|....:.:|    |:::    :.||:.||
  Rat   245 LPDQAVVQIFVYLTFKD---LVSCSQVNRSWMSMIQRGSLWNSIDFSTVKNIADRCVVTTLQKWR 306

  Fly    67 TFLWLCGSRIGTLESHFDDDHPLQLLPMISRHCY----RLKSISIYNATVARAQPYLLRMSSLEK 127
                                  |.:|.:..|.|.    .|||:|              ...:|::
  Rat   307 ----------------------LNVLRLNFRGCVLRAKTLKSVS--------------HCKNLQE 335

  Fly   128 VHVRNYKSTSKDLIKAIGIHLPRVNSLSL-----------------ESFERKELQEVRQFSEMLE 175
            ::|.:..|.:.:.::.|....|.|..|:|                 .:.:...|...|:|::.  
  Rat   336 LNVSDCPSFTDESMRHISEGCPGVLYLNLSNTTITNRTMRLLPRYFHNLQNLSLAYCRKFTDK-- 398

  Fly   176 LGLYDDVTASEFATIVKPMRKLRCLQLRNAKRFLTTSNLRMLATNCRHLEKLTFND----CDADL 236
             ||       ::..:.....||..|.|....: ::....|.:|.:|..:..||.||    .|..:
  Rat   399 -GL-------QYLNLGNGCHKLIYLDLSGCTQ-ISVQGFRNIANSCTGIMHLTINDMPTLTDNCV 454

  Fly   237 LVL----PQFVNLKYLQLYCSEDMKTRLFKALAKSQCSIQLEYLILHRKRWID---EEQAQYISA 294
            .||    |:..::.::.   |..:....||||  |.|.:: :......||..|   :...:....
  Rat   455 KVLVEKCPRISSVVFIG---SPHISDCAFKAL--SACDLK-KIRFEGNKRITDACFKSVDRNYPG 513

  Fly   295 LKCLRWLVCKPRDDLCVHHLAKLSRLECLSIQSAREIGETQL-------------SLLVAN---- 342
            :..:..:.||...|..:..|:.|.:|..|::.:...||:..|             .|.:||    
  Rat   514 ISHIYMVDCKGLTDSSLKSLSVLKQLTVLNLTNCVRIGDIGLRQFFDGPASVKLRELNLANCSLL 578

  Fly   343 --------NER---LRYLNICYCLGITDAFVLDTLASL 369
                    :||   |.|||:..|..:|| ..::.:||:
  Rat   579 GDTSVIRLSERCPNLHYLNLRNCEHLTD-LAIEYIASM 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 6/26 (23%)
leucine-rich repeat 224..244 CDD:275381 8/28 (29%)
leucine-rich repeat 245..272 CDD:275381 7/27 (26%)
leucine-rich repeat 273..297 CDD:275381 3/27 (11%)
leucine-rich repeat 298..319 CDD:275381 5/21 (24%)
leucine-rich repeat 320..345 CDD:275381 9/50 (18%)
leucine-rich repeat 346..372 CDD:275381 9/25 (36%)
Fbxl13NP_001096825.2 F-box-like 242..288 CDD:289689 10/46 (22%)
leucine-rich repeat 257..270 CDD:275381 4/16 (25%)
leucine-rich repeat 282..308 CDD:275381 7/48 (15%)
AMN1 308..477 CDD:187754 36/197 (18%)
leucine-rich repeat 309..327 CDD:275381 6/18 (33%)
leucine-rich repeat 333..358 CDD:275381 5/25 (20%)
leucine-rich repeat 359..383 CDD:275381 3/24 (13%)
leucine-rich repeat 384..411 CDD:275381 5/37 (14%)
leucine-rich repeat 412..437 CDD:275381 6/26 (23%)
leucine-rich repeat 438..463 CDD:275381 8/25 (32%)
leucine-rich repeat 464..486 CDD:275381 6/27 (22%)
AMN1 475..607 CDD:187754 31/136 (23%)
leucine-rich repeat 488..538 CDD:275381 8/51 (16%)
leucine-rich repeat 539..566 CDD:275381 5/27 (19%)
leucine-rich repeat 567..592 CDD:275381 5/25 (20%)
leucine-rich repeat 593..617 CDD:275381 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.