DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32191 and sul-2

DIOPT Version :10

Sequence 1:NP_730304.2 Gene:CG32191 / 317903 FlyBaseID:FBgn0052191 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_505102.1 Gene:sul-2 / 179194 WormBaseID:WBGene00006309 Length:452 Species:Caenorhabditis elegans


Alignment Length:99 Identity:26/99 - (26%)
Similarity:39/99 - (39%) Gaps:29/99 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 PLSLSLSLPQLVVANMAWPNQWVILIGSFLSTLGAGLQSLTGAP-RLLQ----------AIAK-- 150
            ||.|||.|...        |.:|.|:|.  |:....|:..|..| :|||          ::::  
 Worm    96 PLLLSLCLDLY--------NGYVTLLGR--SSHQTRLKPTTSLPNQLLQDDDDCISDIDSVSEVS 150

  Fly   151 ---DGIIPF---LEPFAVSSKRGEPTRALILTLL 178
               :..:.|   .:|.|||.|..|....|:...|
 Worm   151 SEVESTLSFQQMKDPTAVSEKVDELVSQLVTASL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32191NP_730304.2 4-S 27..408 CDD:293753 26/99 (26%)
sul-2NP_505102.1 ALP_like 32..388 CDD:474031 26/99 (26%)

Return to query results.
Submit another query.