DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and AT5G67170

DIOPT Version :10

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_201518.2 Gene:AT5G67170 / 836852 AraportID:AT5G67170 Length:375 Species:Arabidopsis thaliana


Alignment Length:138 Identity:37/138 - (26%)
Similarity:61/138 - (44%) Gaps:17/138 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMTLKRRIFEKEIPGD--FDSYM 86
            |::.||.......|.:..||.||:|:...:..|.:.|...|.::...|.:||..|..|  |:.|.
plant    32 LDALGLKIIQVTADGNCFFRAIADQLEGNEDEHNKYRNMIVLYIVKNREMFEPFIEDDVPFEDYC 96

  Fly    87 QDMSKPKTYGTMTELRAMSCLYRRNVILYEPYNMGTSVVFNRRYAENF--------RVFFNNENH 143
            :.|....|:....||:|.|.:.|.|:.::.  ||..     |.|..||        .:.:::..|
plant    97 KTMDDDGTWAGNMELQAASLVTRSNICIHR--NMSP-----RWYIRNFEDTRTRMIHLSYHDGEH 154

  Fly   144 FDSVYDVE 151
            ::||...|
plant   155 YNSVRSKE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU_ALG13-like 21..149 CDD:438590 36/134 (27%)
Tudor_TDRD13-like 336..389 CDD:410451
AT5G67170NP_201518.2 OTU_plant_OTU7-like 36..159 CDD:438608 34/129 (26%)
SecA <274..330 CDD:440418
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.