DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and AT5G03330

DIOPT Version :10

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_195953.1 Gene:AT5G03330 / 831875 AraportID:AT5G03330 Length:356 Species:Arabidopsis thaliana


Alignment Length:124 Identity:29/124 - (23%)
Similarity:58/124 - (46%) Gaps:21/124 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DASSLFRVIAEQMYDTQMLHYEIRLECVRFMTLKRRIFEKEIPGDFDSYMQDMSKPKTYGTMTEL 101
            |.:..||.:|:|:|.|...|..:|.:.|:.:..:...::..:|.||..|::.||:...:|....|
plant   221 DGNCQFRALADQLYKTADRHKHVRRQIVKQLKSRPDSYQGYVPMDFSDYLRKMSRSGEWGDHVTL 285

  Fly   102 RAMSCLYRRNVILYEPYN-------MGTS-----VVFNRRYAENFRVFFNNENHFDSVY 148
            :|.:..||..:::...:.       :.||     |:|         :.|..|.|::::|
plant   286 QAAADAYRVKIVVLTSFKDTCYIEILPTSQESKGVIF---------LSFWAEVHYNAIY 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU_ALG13-like 21..149 CDD:438590 29/124 (23%)
Tudor_TDRD13-like 336..389 CDD:410451
AT5G03330NP_195953.1 OTU_plant_OTU9-like 204..335 CDD:438588 28/122 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.