DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and AT5G04250

DIOPT Version :10

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_568136.1 Gene:AT5G04250 / 830304 AraportID:AT5G04250 Length:345 Species:Arabidopsis thaliana


Alignment Length:58 Identity:14/58 - (24%)
Similarity:29/58 - (50%) Gaps:4/58 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 QNSFVIVSLNSVTSGLTSLLLCYKVLKLK-KSGIQPNLQ--YSCQIIQLISTIAVIES 227
            :||.|||....: .|:.:....|.:.:.: :||...:::  .|..:.||..|..::|:
plant    66 KNSSVIVRRIPI-GGVKTASKSYVISRTEPQSGTSKSIEDASSISLAQLTKTANLVEA 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU_ALG13-like 21..149 CDD:438590
Tudor_TDRD13-like 336..389 CDD:410451
AT5G04250NP_568136.1 OTU_plant_OTU9-like 195..326 CDD:438588
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.