DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and AT3G22260

DIOPT Version :10

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_974352.1 Gene:AT3G22260 / 821796 AraportID:AT3G22260 Length:245 Species:Arabidopsis thaliana


Alignment Length:148 Identity:31/148 - (20%)
Similarity:65/148 - (43%) Gaps:12/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SRQAPDPYDQYLE---------SRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMT 68
            :|:.||..|..|:         :.||.......|.:..||.:|:|::.....|..:|...|:.:.
plant    76 NREIPDINDATLDHELLSGRLATYGLAELQMEGDGNCQFRALADQLFRNADYHKHVRKHVVKQLK 140

  Fly    69 LKRRIFEKEIPGDFDSYMQDMSKPKTYGTMTELRAMSCLYRRNVILYEPYNMGTSVVF---NRRY 130
            .:|:::|:.:|..:..|.:.|.|...:|....|:|.:..:...:.|...:...:.:..   |:..
plant   141 QQRKLYEEYVPMKYRHYTRKMKKHGEWGDHVTLQAAADRFEAKICLVTSFRDQSYIEILPHNKNP 205

  Fly   131 AENFRVFFNNENHFDSVY 148
            .....:.|.:|.|::|:|
plant   206 LREAWLSFWSEVHYNSLY 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU_ALG13-like 21..149 CDD:438590 28/140 (20%)
Tudor_TDRD13-like 336..389 CDD:410451
AT3G22260NP_974352.1 OTU_plant_OTU9-like 92..223 CDD:438588 25/130 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.