DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and AT3G02070

DIOPT Version :10

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_186856.1 Gene:AT3G02070 / 821202 AraportID:AT3G02070 Length:219 Species:Arabidopsis thaliana


Alignment Length:133 Identity:31/133 - (23%)
Similarity:61/133 - (45%) Gaps:3/133 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QYLESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMTLKRRIFEKEIPGDFDSYM 86
            |.|...||.....:.|.:..||.:::|:|.:...|.::|.|.|:.:...|.::|..:|..:..|.
plant    72 QRLNVYGLCELKVSGDGNCQFRALSDQLYRSPEYHKQVRREVVKQLKECRSMYESYVPMKYKRYY 136

  Fly    87 QDMSKPKTYGTMTELRAMSCLYRRNVILYEPYNMGTSVVFNRRYAENFRVF---FNNENHFDSVY 148
            :.|.|...:|....|:|.:..:...:.|...:.....:....:|.....|.   |.:|.|::|:|
plant   137 KKMGKFGEWGDHITLQAAADRFAAKICLLTSFRDTCFIEIIPQYQAPKGVLWLSFWSEVHYNSLY 201

  Fly   149 DVE 151
            |::
plant   202 DIQ 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU_ALG13-like 21..149 CDD:438590 29/129 (22%)
Tudor_TDRD13-like 336..389 CDD:410451
AT3G02070NP_186856.1 OTU_plant_OTU9-like 70..201 CDD:438588 29/128 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.