DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and AT3G02070

DIOPT Version :9

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001319447.1 Gene:AT3G02070 / 821202 AraportID:AT3G02070 Length:219 Species:Arabidopsis thaliana


Alignment Length:133 Identity:31/133 - (23%)
Similarity:61/133 - (45%) Gaps:3/133 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QYLESRGLYRKHTARDASSLFRVIAEQMYDTQMLHYEIRLECVRFMTLKRRIFEKEIPGDFDSYM 86
            |.|...||.....:.|.:..||.:::|:|.:...|.::|.|.|:.:...|.::|..:|..:..|.
plant    72 QRLNVYGLCELKVSGDGNCQFRALSDQLYRSPEYHKQVRREVVKQLKECRSMYESYVPMKYKRYY 136

  Fly    87 QDMSKPKTYGTMTELRAMSCLYRRNVILYEPYNMGTSVVFNRRYAENFRVF---FNNENHFDSVY 148
            :.|.|...:|....|:|.:..:...:.|...:.....:....:|.....|.   |.:|.|::|:|
plant   137 KKMGKFGEWGDHITLQAAADRFAAKICLLTSFRDTCFIEIIPQYQAPKGVLWLSFWSEVHYNSLY 201

  Fly   149 DVE 151
            |::
plant   202 DIQ 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU 37..>115 CDD:303090 18/77 (23%)
TUDOR 335..392 CDD:197660
TAF12 <446..>564 CDD:304643
AT3G02070NP_001319447.1 OTU 86..>170 CDD:418725 19/83 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.