DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otu and CG7857

DIOPT Version :10

Sequence 1:NP_511089.2 Gene:otu / 31789 FlyBaseID:FBgn0003023 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_648769.2 Gene:CG7857 / 39671 FlyBaseID:FBgn0026738 Length:312 Species:Drosophila melanogaster


Alignment Length:100 Identity:25/100 - (25%)
Similarity:42/100 - (42%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LESRGLYRKHTARDASSLFRVIAEQMYDTQMLHY---EIRLECVRFM-----TLKRRIFEKEIPG 80
            |..|.|...:...|...|::.|..|:....:..:   |:|.|...::     :|...:...| .|
  Fly   167 LSQRQLSLHNIPSDGDCLYQSIRHQLIVNALPGHSVQELREETANYVRAHKDSLISYMIHPE-TG 230

  Fly    81 D------FDSYMQDMSKPKTYGTMTELRAMSCLYR 109
            |      |:.|..|::|...:|...||:|:|.|.|
  Fly   231 DILNDQQFEQYCHDIAKTHAWGGHIELKAISSLLR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otuNP_511089.2 OTU_ALG13-like 21..149 CDD:438590 24/99 (24%)
Tudor_TDRD13-like 336..389 CDD:410451
CG7857NP_648769.2 COG5539 17..307 CDD:227826 24/99 (24%)
OTU_OTUD6 163..309 CDD:438598 24/99 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.