DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32121 and BtbVII

Sequence 1:NP_001097599.1 Gene:CG32121 FlyBaseID:FBgn0052121 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster

Alignment Length:760 Identity:186/761 (24%)
Similarity:281/761 (37%) Gaps:232/761 (30%)


  Fly    26 SQQQFCLRWHNHQTSLLSTLPILLDQSHLTDVTISAEGRQLRAHRVVLSACSSFFMDIFRALEAS 90
            |.|||||||:|||.:.:|....||....|.|||::||||||:||::|||||||:|..:| .....
  Fly     2 SVQQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALF-TTNPC 65

  Fly    91 NHPVIIIPGASFGAIVSLLTFMYSGEVNVYEEQIPMLLNLAETLGIKGLADVQNNNLPKTARSGG 155
            .||::|:....:..:.:::.|||.|||||.:||:|.:|..||.|.|||||               
  Fly    66 QHPIVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLA--------------- 115

  Fly   156 GSYMDTTNEKSSEFERPTTPSPTPTPTLTPSHTPTPSHSLPLPQLPSAALNTPLLANKLGSVNSS 220
                          |.||.|:     .||.|.:.:.:....:  :..|.:.|. ..|..||: .:
  Fly   116 --------------EMPTDPA-----NLTKSDSKSSTDGTEM--VGGAGVGTG-AGNSAGSL-GA 157

  Fly   221 GMGTTPLENLFKSLQFYPSLLPQPLNFSQTALNKTTELLAKYQQQCQLYQSGMQEDQ-------- 277
            |.|::..::|:.|.:.......|    .|.|..:..:....:|||.||.|...|..|        
  Fly   158 GSGSSVGDSLWSSSEAQQFQQQQ----QQQAQQQAQQQHHHHQQQQQLQQQQQQAQQQQQQQQHH 218

  Fly   278 --------------LETDCFGSKRL-----KGDSPPKELRRLEKSLLKNPKSSSTTNSSSSKSPQ 323
                          .:|.....:|.     .|.||....:||.|         |:.|.|..::..
  Fly   219 HHHHQQQQSGQAQAAQTHHHQMRRTPSPLSAGTSPATRRKRLRK---------SSNNGSGDRNNA 274

  Fly   324 ECSNPNPIVATSPVTLAPPTMAHFSP------------QLPVVKCSSASYPSAL----------- 365
            |..:.:.:.|.|....|..::|..:.            .|...|....|..:.|           
  Fly   275 EEQHNSSLDAGSGAGNAGLSLAQMNQMTFGAGGGLAGHSLHAAKLLKESASAELEQQPQDSDLDD 339

  Fly   366 GQGQLYSS-KP-----------PL-YSAAVTPTA--AQQAAQMHHHPQPGPSPYISAEDHAKLQL 415
            |.|.|:.. ||           || .|...||:.  |..:...|..|.|..:|:   ..|..|  
  Fly   340 GHGHLHMQIKPEVDIGGVNQTMPLDISGGTTPSEHDAPNSQSSHSEPSPAHAPH---PPHPPL-- 399

  Fly   416 HIEQYQREAAAAAAAAAGGM----------ALVSAKSEP-----NLLSLSADRDKSLATAP-IKP 464
                      .||::::||.          .:.|.:.:|     :...:...|::.|...| :|.
  Fly   400 ----------GAASSSSGGSGSFERSFSIGGVGSVECDPDGTPSSPAVMGTKRNRVLTRQPRVKR 454

  Fly   465 PSNSKLYATCFICHKQLS----------NQYNLRVHLETHQNVRYACNVCSHVSRSKDALRKHVS 519
            .|:| :.:|     .|:|          :.:|...  .|....|......||....:.|:..|..
  Fly   455 DSDS-ISST-----NQISPDTAATTLDFDPFNAAG--ATSATARDYSTTGSHHLHHQSAVHHHHH 511

  Fly   520 Y--------RHPGAPSPCENEARRKRVSKLAATT-----VPTSTPM-----------SMSASHTV 560
            .        ||...|:|           .||.:|     ||:|||.           ..||.|..
  Fly   512 LLTVPPRIERHASEPAP-----------SLAPSTPHLLSVPSSTPYLIKQHSDPLLPRQSALHMA 565

  Fly   561 TSGDVGPAPATTLGCSGQEARNPYLFLPNQFQ--MAAAAAA------------VAVAESSPASGQ 611
            .||. |.:.|...|      .||:..|..|:.  ::.:.|:            :::.||..|||.
  Fly   566 GSGS-GSSSAMATG------SNPFAPLHRQYSHPLSGSNASYVTPAPLHHPHHISLPESIYASGS 623

  Fly   612 PS--------LDLAHEAPPSIKSE--REPPTASNGEATGVEASAS 646
            |.        :.....|.|.:.||  ..|..||.|.::.|.|:.|
  Fly   624 PPPAGSSQYLVPTRVVACPVVSSETAATPTNASPGSSSTVSAAVS 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32121NP_001097599.1 BTB 48..142 CDD:279045 46/94 (49%)
BTB 56..149 CDD:197585 43/93 (46%)
C2H2 Zn finger 474..494 CDD:275370 4/30 (13%)
C2H2 Zn finger 501..518 CDD:275370 4/17 (24%)
BtbVIINP_647774.2 BTB 24..117 CDD:279045 47/123 (38%)
BTB 32..117 CDD:197585 44/115 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.