DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and ULP1A

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_187347.2 Gene:ULP1A AraportID:AT3G06910 Length:502 Species:Arabidopsis thaliana

Alignment Length:245 Identity:75/246 (30%)
Similarity:126/246 (51%) Gaps:17/246 (7%)


  Fly   171 KQSVHVIEDIRISSELIPLTKEHHDRLMELSKYPLQQVIVA--KFNLDICGSDIKILTSGGWLND 233
            ::.|.|::    ....:||::|....:..........::|.  ..|:||.|..::.|..|.||||
plant   258 EEPVEVVQ----REAFVPLSREEETAVRRAFSANDSNILVTHKNSNIDITGKILRCLKPGKWLND 318

  Fly   234 KIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQS----GFDGVKRWTRK----VDLFSMDL 290
            ::||.||.||.||..:.|......:..:|||..:|:.|    .:..|:|||..    ..|...|.
plant   319 EVINLYMVLLKEREAREPKKFLKCHFFNTFFFTKLVNSATGYNYGAVRRWTSMKRLGYHLKDCDK 383

  Fly   291 ILVPVHQMLVHWCLVIIDLPAKTMLYYNS-RGRGDPNLMRALVKYLQMESEDKLGLCLDTSEFRI 354
            |.:|:| |.:||.|.:|::..:...|.:| :|| :|.::.||.:|...|..||..:.||.|.:|.
plant   384 IFIPIH-MNIHWTLAVINIKDQKFQYLDSFKGR-EPKILDALARYFVDEVRDKSEVDLDVSRWRQ 446

  Fly   355 EDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMVLEL 404
            |..|::|.|.|..|||:|:..:.::.:|...:.|:::.|.|||.:...|:
plant   447 EFVQDLPMQRNGFDCGMFMVKYIDFYSRGLDLCFTQEQMPYFRARTAKEI 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 62/179 (35%)
ULP1ANP_187347.2 PLN03189 37..502 CDD:215622 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I1790
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoInspector 1 1.000 T32349
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.704 Consistency score
76.970

Return to query results.
Submit another query.