DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and Senp2

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_008767027.1 Gene:Senp2 RGDID:708378 Length:593 Species:Rattus norvegicus

Alignment Length:481 Identity:143/482 (30%)
Similarity:228/482 (47%) Gaps:113/482 (23%)


  Fly    24 DYPMAKTMPVLKQPE------NFQEQEEDVVMAVQEKLKFFRKLTSNGPAVPTPLKVVEK----- 77
            |||..:......||.      .|..:.|.     ..:....|:.:.:.|....|.|..|:     
  Rat   130 DYPKIRVTVARDQPRRVLPSFGFTLKSEG-----YNRRPSGRRHSKSNPESSLPWKPQEQGVTEM 189

  Fly    78 --EDIG------HKEIPKVVKKVDRK--TKLLQAI----------PAVFKHSHNRRFRRSL---- 118
              |:.|      |..:.:.|:|.:|:  .|||:.:          |||..||..|....:|    
  Rat   190 ISEEGGKGARRPHCTVEEGVQKDEREKYLKLLERLKEGAHGSTFPPAVSHHSSQRTQMDTLKTKG 254

  Fly   119 -------FLRSNYI--EQFR---------------RWTDQKNKLNRKRL---------NEAHQLC 150
                   .:|:.::  :|:|               |::  |.|.:.:::         ...||| 
  Rat   255 WMEEQNHGVRTTHLVPKQYRVVETRGPLCSVRSEKRYS--KGKADTEKVVGLRFEKDGTRGHQL- 316

  Fly   151 LKAKHERIACEIDRYKKL------ILKQSVHVI----------EDIRISSELIPLTKEHHDRLME 199
                ...::.|:....:|      :|::.:.|:          |..|.:.:|..|| ||  ||::
  Rat   317 ----EPDLSEEVSARLRLGSGSNGLLRRKISVLEAKEKNFPSKEKDRRTEDLFELT-EH--RLIQ 374

  Fly   200 ---------LSKYPLQQVIVAKFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVP 255
                     |...|..:::.:.|.|.|...||:.|.:..||||::||||||||||||:|:  ..|
  Rat   375 DMEKEISNALGHGPPDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYMNLLVERSKKQ--GYP 437

  Fly   256 SVYAMSTFFVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSR 320
            :::|:||||.|:|...|:..|||||:.|:||..:|:|||:|:. |||.||::||..|.:.|.:|.
  Rat   438 ALHALSTFFYPKLKSGGYQAVKRWTKGVNLFDQELVLVPIHRK-VHWSLVVMDLRKKCLKYLDSM 501

  Fly   321 GRGDPNLMRALVKYLQMESEDKLGLCLDTSEFRIEDAQ--NVPQQDNMNDCGVFVCMFAEYLTRD 383
            |:....:...|::|||.||:.|....|:..|:.....:  .:|||.|.:|||:|.|.:|:|::||
  Rat   502 GQKGHRICEILLQYLQDESKTKRNTDLNLLEWTHYSMKPHEIPQQLNGSDCGMFTCKYADYISRD 566

  Fly   384 APITFSKKDMKYFRTKMVLELTGDQL 409
            .||||::..|..||.|||.|:...||
  Rat   567 KPITFTQHQMPLFRKKMVWEILHQQL 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 80/172 (47%)
Senp2XP_008767027.1 Peptidase_C48 <372..588 CDD:304959 92/219 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T131225
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.774 Consistency score
TreeFam 1 0.960
76.880

Return to query results.
Submit another query.