DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and LOC683408

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_006225127.1 Gene:LOC683408 RGDID:1586882 Length:476 Species:Rattus norvegicus

Alignment Length:465 Identity:134/466 (29%)
Similarity:215/466 (46%) Gaps:107/466 (23%)


  Fly    20 KECQDYPMAKTMPVLKQPEN-------------FQEQE----------ED-----------VVMA 50
            ::|||    .|..|.|:|..             ||.::          ||           ...|
  Rat    43 RKCQD----GTEMVFKEPGKALKKTPQEYQDLAFQREQPGKAQGQTPLEDGSRKLNPLEYPPXQA 103

  Fly    51 VQEKLKFFRKLTSNGPAVPTPLKVVEKEDIGHKEIPKVVKKVDRKTKLLQAIPAVFKHSH----- 110
            :.||     |.|.:|.........:|::|    :.|: .:|.::..:.||....|..:.|     
  Rat   104 ITEK-----KFTDSGKDRKRRYSFLEEKD----QXPQ-KEKYEKSLQXLQCGHPVRSYPHRPHPX 158

  Fly   111 ------NRRFRRSLFLRSNYIEQFRRWTDQKNKLNRKRLNEAHQLCLKAKHERIACEIDRYKKLI 169
                  |:|.|......|..::             |.|......||.|:  |:...|....:...
  Rat   159 LYDTLKNKRGRSGHPHGSETVQ-------------RDREPSTEVLCTKS--EKRXAEEKSXRGNS 208

  Fly   170 LKQSVHVIEDIRI----------------SSELIPLTKEHHDRLME------------LSKYPLQ 206
            |:..:...|:..|                .:|..|||.:..:|.:|            |...|..
  Rat   209 LEPGLPGTENANILTSGRGRLLPNKLPVLVAEKKPLTDQEKNREIEVTHEMEKEIKKGLCPGPQN 273

  Fly   207 QVIVAKFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQS 271
            :::.:.|.|.|...||:.|.:|.||||::|||||||.|:|::.:  ..|:::|.||||.|:|...
  Rat   274 EIMSSGFKLQITKGDIQTLKNGQWLNDEVINFYMNLPVQRNQNQ--GYPALHAFSTFFYPKLKHG 336

  Fly   272 GFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQ 336
            |::.||:|||.:::|..:|||||:||. |||.||:|||..::::|.:|.|:...|:...:..|||
  Rat   337 GYNFVKKWTRGINIFEKELILVPIHQR-VHWSLVVIDLRKRSIVYLDSMGQTGKNICETIFHYLQ 400

  Fly   337 MESEDKLGLCLDTSEFRIED--AQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTK 399
            .||:.:..:.||..|::...  :|.:|||.|.:|||:|.|.:|:|::||.|:|||::.|..||.:
  Rat   401 NESKTRRNMELDPVEWKQYSLTSQEIPQQLNGSDCGMFTCKYADYISRDQPVTFSQQHMPLFRKR 465

  Fly   400 MVLELTGDQL 409
            ||.|:....|
  Rat   466 MVWEILHSHL 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 76/172 (44%)
LOC683408XP_006225127.1 Peptidase_C48 296..475 CDD:280975 79/182 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.