DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and RGD1564247

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_003749289.1 Gene:RGD1564247 RGDID:1564247 Length:750 Species:Rattus norvegicus

Alignment Length:329 Identity:91/330 (28%)
Similarity:157/330 (48%) Gaps:68/330 (21%)


  Fly   126 EQFRRWTD---QKNKLNRKRLNEAHQLCLKAKHERIACEIDRYKKLIL----KQSVHVIEDIRIS 183
            |.|:...|   ::|.|:.|.|:  |..|.......:.|...:.:..:.    .|:...::|.::|
  Rat   433 ENFQMEEDGSLRQNILSSKLLD--HPYCKSPLDAPLVCSELKVENQVAGGKSGQTASPVDDEQLS 495

  Fly   184 S--------------ELIPLT-KEHHDRL----------------MELSKYPLQQ------VIVA 211
            :              .|:||: |:...||                .|::.|.::.      :...
  Rat   496 TCLSGFLDEVMKKYGSLVPLSEKDVLGRLKDVFNEDFSNRKPFINREITNYRVRHQKCNFXIFYN 560

  Fly   212 KFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVP-SVYAMSTFFVPRLLQSGFDG 275
            |..||:  .|:..|....||||::||.|..|:::       .|| .|:..::||..:|:..|::|
  Rat   561 KHMLDM--DDLATLDGQNWLNDQVINMYGELIMD-------AVPDKVHFFNSFFHRQLVTKGYNG 616

  Fly   276 VKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQMESE 340
            |||||:|||||...|:|:|:| :.|||.|:.:.|.::.:.:|:|:|......:..:.|||..|:.
  Rat   617 VKRWTKKVDLFKKSLLLIPIH-LEVHWSLITVTLSSRIISFYDSQGIHFKFCVENIRKYLLTEAR 680

  Fly   341 DKLGLCLDTSEFRIEDAQN-----VPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKM 400
            :|     :..|| ::..|.     :|||.|.:||||||..:.:.|..:.|..||::||...|.::
  Rat   681 EK-----NRPEF-LQGWQTAVTKCIPQQKNDSDCGVFVLQYCKCLALEQPFQFSQEDMPRXRKRI 739

  Fly   401 VLEL 404
            ..||
  Rat   740 YKEL 743

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 63/176 (36%)
RGD1564247XP_003749289.1 HDPD 116..>165 CDD:280992
Peptidase_C48 576..748 CDD:280975 65/183 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.