DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and SENP2

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_067640.2 Gene:SENP2 HGNCID:23116 Length:589 Species:Homo sapiens

Alignment Length:254 Identity:100/255 (39%)
Similarity:153/255 (60%) Gaps:16/255 (6%)


  Fly   169 ILKQSVHVIED----------IRISSELIPLTKEHHDRLME-LSKYPLQQVIVAKFNLDICGSDI 222
            :|::.|.:||.          .|.:.:|:.||::....:.. |...|..:::.:.|.|.|...||
Human   338 LLRRKVSIIETKEKNCSGKERDRRTDDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDI 402

  Fly   223 KILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQSGFDGVKRWTRKVDLFS 287
            :.|.:..||||::|||||||||||::|:  ..|:::..||||.|:|...|:..|||||:.|:||.
Human   403 QTLKNYHWLNDEVINFYMNLLVERNKKQ--GYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFE 465

  Fly   288 MDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQMESEDKLGLCLDTSEF 352
            .::||||:|:. |||.||:|||..|.:.|.:|.|:....:...|::|||.||:.|....|:..|:
Human   466 QEIILVPIHRK-VHWSLVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEW 529

  Fly   353 RIEDAQ--NVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMVLELTGDQL 409
            .....:  .:|||.|.:|||:|.|.:|:|::||.||||::..|..||.|||.|:...||
Human   530 THHSMKPHEIPQQLNGSDCGMFTCKYADYISRDKPITFTQHQMPLFRKKMVWEILHQQL 588

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 79/172 (46%)
SENP2NP_067640.2 Nuclear localization signal. {ECO:0000269|PubMed:16738331} 28..31
Nuclear localization signal. {ECO:0000269|PubMed:16738331} 46..51
Nuclear export signal 317..332
ULP1 <384..589 CDD:227489 91/209 (44%)
Protease 396..560 73/167 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2988
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T130206
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.774 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1601
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.