DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and SENP7

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_011511340.1 Gene:SENP7 HGNCID:30402 Length:1051 Species:Homo sapiens

Alignment Length:468 Identity:94/469 (20%)
Similarity:158/469 (34%) Gaps:171/469 (36%)


  Fly    38 ENFQEQEEDVVMAVQEKLKFFRKLTSNGPAVPTPLKVVEKEDIGHKEIPKVVKKVDRKTKL---- 98
            :..|.|.|..|::.|.|...|..|..:.|       |.::|::..|:|...:..:..:.:|    
Human   599 QEIQTQLEHSVLSQQSKSSEFIFLELHNP-------VSQREELKLKDIMTEISIISGELELSYPL 656

  Fly    99 --LQAIPAVFKHSHNRRFRRSLFLRSNYIEQFRRWTDQKNKLNRKRLNEAHQLCLKAKHERIACE 161
              :||.|              ||                ..|:.|..:..|..|:.      .|.
Human   657 SWVQAFP--------------LF----------------QNLSSKESSFIHYYCVS------TCS 685

  Fly   162 IDRYKKLILKQSVHVIEDIRISSELIP------------------------LTKEHHDRLMELSK 202
                    ....|.|.|::::.|...|                        :|....:...|:..
Human   686 --------FPAGVAVAEEMKLKSVSQPSNTDAAKPTYTFLQKQSSGCYSLSITSNPDEEWREVRH 742

  Fly   203 YPLQQVIV------AKFNLDICGSDIKILTSGGWLNDKIINFYMN-LLVERSEKRPGTVPSVYAM 260
            ..|.|.::      .|..|.:...|::.|..|.:|||.||:||:. |::|::...  .|...:..
Human   743 TGLVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLILEKASDE--LVERSHIF 805

  Fly   261 STFFV--------------PRL--LQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVII-- 307
            |:||.              |.|  .|.....|:.|||.:::|:.|.|.|||::. .||.|.:|  
Human   806 SSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWTRHINIFNKDYIFVPVNES-SHWYLAVICF 869

  Fly   308 ---------DLPA---------------KT----------------------------------- 313
                     |.|.               ||                                   
Human   870 PWLEEAVYEDFPQTVSQQSQAQQSQNDNKTIDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRP 934

  Fly   314 --MLYYNSRGRGDPNLMRALVKYLQMESEDKLGLCLDTSEFRIED-AQNVPQQDNMNDCGVFVCM 375
              ::..:.:.....|.::.|.:||::|.|.||......|:..:.| ...||:|||.:||||::..
Human   935 CILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQFSKTNMVDLCPKVPKQDNSSDCGVYLLQ 999

  Fly   376 FAEYLTRDAPITF 388
            :.|...:|..:.|
Human  1000 YVESFFKDPIVNF 1012

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 56/241 (23%)
SENP7XP_011511340.1 Peptidase_C48 775..1012 CDD:304959 55/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.