DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and senp5

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001073666.2 Gene:senp5 ZFINID:ZDB-GENE-050208-772 Length:487 Species:Danio rerio

Alignment Length:272 Identity:75/273 (27%)
Similarity:135/273 (49%) Gaps:48/273 (18%)


  Fly   133 DQKNKLNRKRLNEAHQLCLKAKHERIACEIDRYKKLILKQSVHVIEDIRISSELIPLTKEHHDRL 197
            |..||:.:..||:..:|        |..|:.:|:..:....:|:                     
Zfish   249 DHLNKIFQADLNDRMKL--------ITAEVAKYRAGLACAPMHL--------------------- 284

  Fly   198 MELSKYPLQQVIVAKFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMST 262
                     ||...|..|.:  .|:..|....|:||::||.|..|::|      .|..:|:..::
Zfish   285 ---------QVTYNKHTLSL--EDLSTLDDQNWVNDQVINMYGELIME------ATNHTVHFFNS 332

  Fly   263 FFVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNL 327
            ||..:.:..|::||:|||:||||||..|||:|:| :.:||.|:.:|:..:.:.:|:|:|......
Zfish   333 FFYRQFVAKGYEGVRRWTKKVDLFSKTLILIPLH-LEIHWSLITVDVSKQNINFYDSQGILFKFA 396

  Fly   328 MRALVKYLQMESEDKLGLCLDTSEFRIEDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKD 392
            :..::||:..|:::| ...|....:::...:.:|||.|.||||.||..:.:.|....|::|:::|
Zfish   397 LDNVMKYIMEEAKEK-KQPLFQKGWKMLINKTIPQQKNDNDCGAFVLEYCKCLAFMKPLSFTQED 460

  Fly   393 MKYFRTKMVLEL 404
            |...|.::..||
Zfish   461 MPRVRKRIYREL 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 57/170 (34%)
senp5NP_001073666.2 Peptidase_C48 305..477 CDD:280975 59/177 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106174700
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.