DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and senp3b

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001077311.1 Gene:senp3b ZFINID:ZDB-GENE-030131-6714 Length:515 Species:Danio rerio

Alignment Length:384 Identity:97/385 (25%)
Similarity:160/385 (42%) Gaps:105/385 (27%)


  Fly   112 RRFRRSLFLRSNYIEQFRRWTDQK---NKLNRKRLNEAHQLCLKAKHER-IACE----------- 161
            ||.|.|..||:..::.::.|..|.   ..|..:|.....|..|.|..:| ..|:           
Zfish   139 RRLRSSARLRNRLVQNWKTWRQQAQWVGTLGYRRARRWRQYSLYASKKREKGCDTKGSTLRGLVT 203

  Fly   162 ---------------------------IDRYKKLILKQSVHVIE-----------------DIRI 182
                                       :..|..:.:|.::..||                 |:|.
Zfish   204 TSERETENQFSAYNGYGDSQSVSSLSGVREYLSMPMKPTIQRIEMTLTEEHKAYVHGLIEDDLRK 268

  Fly   183 SSELIPLTKEHHDRLMEL-------------SKYPLQQVI-----------VAKFNLD-----IC 218
            ...|||:   |.|.:.|.             .|..:|.:|           |..|.::     :.
Zfish   269 YGSLIPV---HADDIAEQLQSIFNEDFSQTHRKMAVQHLIQSYQRSSGTAMVKGFRVNYKRHVLT 330

  Fly   219 GSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVP-SVYAMSTFFVPRLLQSGFDGVKRWTRK 282
            ..|:..|....||||:::|.|.:|:::       :|| .|:..::||..:|...|:|||||||:.
Zfish   331 MDDLSTLYGQNWLNDQVMNMYGDLVMD-------SVPEKVHFFNSFFYDKLRTKGYDGVKRWTKN 388

  Fly   283 VDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQMES--EDKLGL 345
            ||:|..||:|:|:| :.|||.||.:|:..:::.|::|:...:....:.:.||||.|:  ::|...
Zfish   389 VDIFQKDLLLIPIH-LEVHWSLVSVDIKRRSITYFDSQRTLNRRCPKHIFKYLQAEAMIKEKRDF 452

  Fly   346 CLDTSEFRIEDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMVLEL 404
            ......|   ...||.:|:|.:|||.||..:.:.|....|.:||::||...|..|..||
Zfish   453 LTGWKGF---FKMNVGRQNNDSDCGAFVLQYCKCLALGQPFSFSQQDMPKLRRMMYKEL 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 60/173 (35%)
senp3bNP_001077311.1 Peptidase_C48 341..513 CDD:280975 63/180 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106174695
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.