DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and senp3a

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001098584.1 Gene:senp3a ZFINID:ZDB-GENE-030131-2303 Length:535 Species:Danio rerio

Alignment Length:498 Identity:119/499 (24%)
Similarity:202/499 (40%) Gaps:153/499 (31%)


  Fly    24 DYPMAKTMPVLKQPENFQEQEE--DVVMAVQEKLK---FFRKLTSNGP----AVPTPLKVVE--- 76
            ||    |:|.::..|..:|:||  ||.|...|.|:   .|. |...|.    ..|...:|.|   
Zfish    67 DY----TVPEVEDEEEEEEEEEEDDVEMESGEDLEDQGIFH-LQDQGDDKDWGTPEHSQVAEMDV 126

  Fly    77 --KEDIGH---KEIPKVVKKVDRKTKLLQAIPAVFKHSHNRRFRRSLFLRSNYIEQFRRWTDQK- 135
              .:|..|   :..|:::     |.:.|..:|        .|.||.|.:|....:.:|.|..:. 
Zfish   127 RVTDDFTHCMAQRRPRLL-----KVRRLARLP--------NRGRRYLSIRFRLAQHWRTWRQRAK 178

  Fly   136 ----------NKLNRKR---------------LN----------EAHQLC-----LKAK---HER 157
                      .:.:|:|               ||          |....|     ||.:   |..
Zfish   179 WAGTMGYRRVRRCHRRRYFGSQHFQRPPGRSLLNGDPEGRLQGTEISDSCSTNGALKGRDGLHGA 243

  Fly   158 IACEID-----------RYKKLILKQ--SVHVI-------EDIRISSELIPLTKEHHDRLMELSK 202
            :..|.:           |.|..:..|  |.|:.       |.::....|||:   |.|.::|   
Zfish   244 VLGEREGRASPTNVQSQREKASLQNQLSSEHISCVQGILDEFLQQYGSLIPI---HVDEVVE--- 302

  Fly   203 YPLQQVIVAKFNLD---------------ICGS------------------DIKILTSGGWLNDK 234
             .||::....|:..               :.||                  |:..|....||||:
Zfish   303 -KLQEIFTESFSSPHRKIMVQHLMQSYQRMSGSAMMRGFRVNYKRHVLVMDDLTTLYGQNWLNDQ 366

  Fly   235 IINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQML 299
            ::|.|.:|:::.:.::      |:..::||..:|...|::||||||:.||:|....:|:|:| :.
Zfish   367 VMNMYGDLVMDAAPEK------VHFFNSFFYDKLRTKGYEGVKRWTKNVDIFQKKFLLIPIH-LE 424

  Fly   300 VHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQMES---EDKLGLCLDTSEFRIEDAQNVP 361
            |||.||.:::|.:::.|::|:...:....:.:.||||.|:   |.|.........|::    ||.
Zfish   425 VHWSLVCVNVPQRSVTYFDSQRTLNRRCPKHIAKYLQAEAIKREQKDFYTGWKGFFKM----NVA 485

  Fly   362 QQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMVLEL 404
            :|:|.:|||.||..:.:.|..:.|.:|.::||...|.:|..||
Zfish   486 RQNNDSDCGAFVLQYCKCLALEQPFSFGQQDMPKLRRQMYKEL 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 55/173 (32%)
senp3aNP_001098584.1 Peptidase_C48 361..533 CDD:280975 58/180 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106174689
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1601
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.