DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and Senp18

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001002834.1 Gene:Senp18 RGDID:1303230 Length:475 Species:Rattus norvegicus

Alignment Length:455 Identity:136/456 (30%)
Similarity:214/456 (47%) Gaps:86/456 (19%)


  Fly    19 TKECQD-YPMAKTMPVLKQPENFQEQEEDVVMAVQEKLKFFRKLTSNGPAVPTPLK------VVE 76
            ::.||| ..|....|...:.:..||.::..:...|......:|....|.....||:      |||
  Rat    42 SRNCQDGAQMVFQKPGKARKKTHQEHQDQKLNKEQPGKGQGQKTQDEGSGNIKPLEGLPDQAVVE 106

  Fly    77 KEDIGHKEIPKVVKKVDRKTKLLQAIPAVFKHSHNRRFRRSLF-------LRSNYIEQFRRWTDQ 134
            |...|.|     .:|  |...:||..|   :...|.:..|||.       :||:.......::|.
  Rat   107 KSTEGGK-----CRK--RPYSVLQEKP---QSPQNEKHARSLEHLQGGHPVRSDPHRPHPTFSDT 161

  Fly   135 KNKL---------------NRKRLNEAHQLCLKAKHERIACE---------------------ID 163
            .|..               :|:...|.    |..|.|:...|                     :|
  Rat   162 SNNKGGMPGHPHGRETAHGDRQPSTEV----LSTKREKRCAEEKCVRGNSLEHGLPGTANANILD 222

  Fly   164 RYKKLILKQSVHVIEDIRISSELIPLTKEHHDRLMELSKY------------PLQQVIVAKFNLD 216
            .....:|...|.|     ::.|...|.::.:::..|.:|.            ..::::...|.|.
  Rat   223 SGGGRLLPDKVAV-----VAGEKNALPEQENNQEKEFTKEMEKEVEKALGPGAQEEILSTGFKLK 282

  Fly   217 ICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQSGFDGVKRWTR 281
            |...|::.|.:|.||||::|||||||||:|:| .|| .|:::|.||||..:|...|::.||||||
  Rat   283 ITRGDMQTLKNGQWLNDEVINFYMNLLVQRNE-NPG-YPALHAFSTFFYAKLKHGGYNSVKRWTR 345

  Fly   282 KVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQMESEDKLGLC 346
            .::||..:|||||:||. |||.||:|||..::::|.:|.|:...|:...:..|||.||:.:..:.
  Rat   346 GINLFEKELILVPIHQR-VHWSLVVIDLRKRSIVYLDSMGQTGKNICETIFHYLQNESKTRRNME 409

  Fly   347 LDTSEFRIED--AQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMVLELTGDQL 409
            ||..|::...  :|.:|||.|.:|||:|.|.:|:|::||.|:|||::.|..||.:||.|:....|
  Rat   410 LDPVEWKQYSLTSQEIPQQLNGSDCGMFTCKYADYISRDQPVTFSQQHMPLFRKRMVWEILHSHL 474

  Fly   410  409
              Rat   475  474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 81/172 (47%)
Senp18NP_001002834.1 Peptidase_C48 <244..470 CDD:304959 92/229 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T131225
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
76.880

Return to query results.
Submit another query.