DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and Gm9839

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001186885.1 Gene:Gm9839 MGIID:3641910 Length:478 Species:Mus musculus

Alignment Length:466 Identity:137/467 (29%)
Similarity:224/467 (48%) Gaps:99/467 (21%)


  Fly    20 KECQDYPMAKTMPVLKQPENFQ----EQEEDVVMAVQEKLK-FFRKLTSNGPAVPTPLKVVE--K 77
            ::|||    .|..|.|.|...|    ::..|:.:.:::..| ..||.....|..|.||::.|  .
Mouse    35 RKCQD----GTKMVFKVPGKAQKMTPQEPPDLELPIEQSSKGQVRKPQGETPNQPKPLELTEGPP 95

  Fly    78 EDI-----------GHK------EIPKVVKKVDRKTKLLQAIPAVF-----------KHSHNRRF 114
            |.:           |||      |..:.:.:.::|.:|||.:..:.           :.||..  
Mouse    96 EQVVTGRVPADSGKGHKRPYSAMEENEQIPQKEKKRRLLQNLKLILIKAGKIKGGESEDSHGS-- 158

  Fly   115 RRSLFLRSNYIEQFRRWTDQKNKLNRKRL---NEAHQLCLK--AKHERIAC---EIDRYKKLILK 171
                       |...|..:....:..|..   :|..:.|.:  :..|:..|   |..|...|...
Mouse   159 -----------ETTLRDPEPSTVVALKECLSPDEREKCCFEETSVTEKKGCVKVEGRRGNSLEPG 212

  Fly   172 QSVHVIEDIRISSELIP-------------LTKEHH---DRLMELSK------------YPLQQV 208
            ....:|.|....:.|:|             ...|.|   |:::::::            .|.:::
Mouse   213 TQAQIILDSSRGNSLLPNKMAVLAAQKKPLRDHEKHREMDQILDITEDMEKEIENALGPGPQEEI 277

  Fly   209 IVAKFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQSGF 273
            :.::|.|.|...||:.|.:..||||::|||||||||||:|.:  ..|:::..||||.|:|..||:
Mouse   278 LSSRFKLQITRGDIQTLKNSQWLNDEVINFYMNLLVERNENQ--GYPALHVFSTFFYPKLKHSGY 340

  Fly   274 DGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQME 338
            ..||||||.::||..:|||||:||.| ||.||:|||..:::.|::|.|:...::...:.:|||.|
Mouse   341 SSVKRWTRGINLFEKELILVPIHQRL-HWSLVVIDLRKQSIAYFDSMGQTGKSICETIFQYLQNE 404

  Fly   339 SEDKLGLCLDTSEFR-----IEDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRT 398
            |:.:..:.||..|::     ||:   :|.|.|.:|||:|.|.:|:|:.||.|:|||::.|..||.
Mouse   405 SKTRRNIELDPLEWKQYSVTIEE---IPLQMNGSDCGMFTCKYADYIARDQPVTFSQQHMPTFRK 466

  Fly   399 KMVLELTGDQL 409
            :||.|:...||
Mouse   467 RMVWEILHSQL 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 80/175 (46%)
Gm9839NP_001186885.1 Peptidase_C48 <231..473 CDD:304959 93/248 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.794 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1601
TreeFam 1 0.960
65.960

Return to query results.
Submit another query.