DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and Gm5415

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001157758.1 Gene:Gm5415 MGIID:3644687 Length:478 Species:Mus musculus

Alignment Length:463 Identity:137/464 (30%)
Similarity:225/464 (48%) Gaps:93/464 (20%)


  Fly    20 KECQDYPMAKTMPVLKQPENFQ----EQEEDVVMAVQEKLK-FFRKLTSNGPAVPTPLKVVE--K 77
            ::|||    .|..|.|.|...|    ::..|:.:|:::..| ..||.....|..|.||::.|  .
Mouse    35 RKCQD----GTTMVFKVPGKAQKMTPQEPPDLELAIEQFSKGQVRKSQGETPNQPKPLELTEGPP 95

  Fly    78 EDI-----------GHK------EIPKVVKKVDRKTKLLQAIPAVF-----------KHSHNRRF 114
            |.:           |||      |..:.:.:.::|.:|||.:..:.           :.||..  
Mouse    96 EQVVTGRAPADSGKGHKRPYSAMEENEQIPQKEKKRRLLQNLKLILIKAGKIKGGESEDSHGS-- 158

  Fly   115 RRSLFLRSNYIEQFRRWTDQKNKLNRKRL---NEAHQLCLK--AKHERIAC---EIDRYKKLILK 171
                       |...|..:....:..|..   :|..:.|.:  :..|:..|   |..|...|...
Mouse   159 -----------ETTLRDPEPSTVVALKECLSPDEREKCCFEETSVTEKKGCVKVEGRRGNSLEPG 212

  Fly   172 QSVHVIEDIRISSELIP-------------LTKEHH---DRLMELSK------------YPLQQV 208
            ....:|.|....:.|:|             ...|.|   |:::::::            .|.:::
Mouse   213 TQAQIILDSSRGNSLLPNKMAVLAAQKKPLRDHEKHREMDQILDITEDMEKEIENALGPGPQEEI 277

  Fly   209 IVAKFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQSGF 273
            :.::|.|.|...||:.|.:|.||||::|||||||||||:|.:  ..|:::..||||.|:|..||:
Mouse   278 LSSRFKLLITRGDIQTLKNGQWLNDEVINFYMNLLVERNENQ--GYPALHVFSTFFYPKLKHSGY 340

  Fly   274 DGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQME 338
            ..||||||.::||..:|||||:||.| ||.||:|||..:::.|::|.|:...::...:.:|||.|
Mouse   341 SSVKRWTRGINLFEKELILVPIHQRL-HWSLVVIDLRKQSIAYFDSIGQTGKSICETIFQYLQNE 404

  Fly   339 SEDKLGLCLDTSEFRIED--AQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMV 401
            |:.:..:.||..|::...  ::.:|.|.|.:|||:|.|.:|:|:.||.|:|||::.|..||.:||
Mouse   405 SKTRRNIELDPLEWKQYSMASEEIPLQMNGSDCGMFTCKYADYIARDQPVTFSQQHMPTFRKRMV 469

  Fly   402 LELTGDQL 409
            .|:...||
Mouse   470 WEILHSQL 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 78/172 (45%)
Gm5415NP_001157758.1 Peptidase_C48 <231..473 CDD:304959 92/245 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T130979
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.794 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1601
TreeFam 1 0.960
87.950

Return to query results.
Submit another query.