DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and velo

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_648056.1 Gene:velo FlyBaseID:FBgn0035713 Length:1833 Species:Drosophila melanogaster

Alignment Length:563 Identity:111/564 (20%)
Similarity:178/564 (32%) Gaps:238/564 (42%)


  Fly     7 EIVEKSRYFDLI---TKECQDYPMA-------KTMPVLKQPENFQEQEEDVVMAVQEKLKFFRKL 61
            ||.|:..|.|..   .::..|.|.|       |...|...|..|:         :.|.:.|    
  Fly  1118 EIDEEPLYKDFSRGDVRDLSDIPEADQFSASLKCSCVRLVPYRFE---------ITEPVCF---- 1169

  Fly    62 TSNGPAVPTPLK-VVEKEDIG-HKEIPKVVKKVDRKTKLLQAIPAVFKHSHNRRFRRSLFLRSNY 124
            |:.|..:...|| ..||.::. ||:  :|:|.:.....:..|.|.|           :|:|....
  Fly  1170 TTKGVRIAGILKDKDEKFELNIHKQ--EVIKVIAHFGNVEPAQPLV-----------TLYLLKTC 1221

  Fly   125 IEQFRRWTDQKNKLNRKRLNEAHQLCLKAKHERIACEIDRY--KKLIL-------------KQSV 174
            .|..      ||:|  |..::.|       ||....:...|  ::|||             |...
  Fly  1222 AEYV------KNQL--KLPDDQH-------HEHTGFKTHSYHTRRLILLFDSISVSARGNIKSMF 1271

  Fly   175 HVIEDIRI--SSELIPLTKEHHDRLMELSKYPL-------QQVIVAKF------NLDICGSDIKI 224
            ..:::|..  ::|::....:...:..:.|..|.       :||.:..:      .|.|...|...
  Fly  1272 SCVDEISSTDAAEILERIADSDRKTQDKSSQPPPRQLRADEQVSLLMYPPKGTGGLCIRMEDFVC 1336

  Fly   225 LTSGGWLNDKIINFYM----NLLVERSEKRPGTVPSVYAMSTFFVPRL-------------LQSG 272
            ||...:|||.||:||:    |.|:...::.     ..:..||||..||             .|..
  Fly  1337 LTKESYLNDIIIDFYLLWLRNTLIPEPQRE-----RTHIFSTFFYKRLTTLTRPADMKQTAAQKR 1396

  Fly   273 FDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLP-AKTMLYYNSRGRGDPNLMR------- 329
            ...|::||:.||:|..|.|:||:::. .||.|.||..| .|..:.:::....:|..::       
  Fly  1397 HARVQKWTKGVDIFDKDFIIVPINEQ-SHWFLAIICYPNLKGPVTFDTNQPVEPQQLKRPRGKKV 1460

  Fly   330 ----------ALVKYLQ--------------------------------MESEDK---------- 342
                      .|.|..:                                |.|||.          
  Fly  1461 ALQIGNTTITPLTKRAEGGQLPAALTAENVCRIADDESERDEAEGDESDMASEDSENSNSAKEPA 1525

  Fly   343 --------------------------------------LGLCLD------------------TSE 351
                                                  |.|..|                  |.|
  Fly  1526 ATPTSTTASTPSLSSSQPTATGPARNIASDDVPAVKQPLILIFDSLAGASRSRVVATLRDYLTCE 1590

  Fly   352 FRIE--DAQ--------------NVPQQDNMNDCGVFVCMFAE 378
            :|::  |||              .||||:|..|||:::..:.|
  Fly  1591 YRVKKPDAQAHVFNKDNMPGHCVKVPQQNNFTDCGLYLLQYVE 1633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 58/299 (19%)
veloNP_648056.1 Peptidase_C48 1342..>1434 CDD:304959 32/98 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.