DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and Den1

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001163126.1 Gene:Den1 FlyBaseID:FBgn0033716 Length:249 Species:Drosophila melanogaster

Alignment Length:281 Identity:64/282 (23%)
Similarity:107/282 (38%) Gaps:58/282 (21%)


  Fly   147 HQLCLKAKHERIACEIDRYKKLILKQSVHVIEDIRISSELIPLTKEHHDRLMELSKYPLQQVIVA 211
            |...:..:|.|.....:|.:......|.|.  .:..:|:..|::...||..:.:           
  Fly     4 HDRKILRQHTRQNQNTNRRRPRFTNNSFHT--KMGSNSKADPISLTFHDSCLRM----------- 55

  Fly   212 KFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQ----SG 272
                    ||:::|....||||:|::||...|.....|       ..|...|..|.:.|    .|
  Fly    56 --------SDVQLLHGPHWLNDQILSFYYEYLAHMKYK-------TNADLHFIAPEITQCMKYMG 105

  Fly   273 FDGVKRWTRKVDLFSMDLILVPVHQMLV------HWCLVIIDLPAKTMLYYNSRGRGDPNLMRAL 331
            ...:|:...:.:......|...::....      ||.|::...|.||..:::|.|..:......|
  Fly   106 DQELKQLLDQSNTTGKPFIFFALNDNETTDAGGSHWSLLVFSRPEKTFYHFDSYGNNNTGNSLEL 170

  Fly   332 VKYLQMESEDKLGLCLDTSEFRIEDAQNVPQQDNMNDCGVFV-CM---FAEYLTR----DAPITF 388
            :..:    :|.||:.:  ::||   .....||.|..|||:.| ||   .|:||.|    |...:.
  Fly   171 MNKI----KDLLGVRM--AKFR---PMRCLQQANGYDCGIHVICMTDHIADYLNRYEVIDGLPSL 226

  Fly   389 SKKDMKYFRT---KMVLELTG 406
            ....:|..||   |::|.|.|
  Fly   227 HIDTVKAKRTELLKLILSLGG 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 48/191 (25%)
Den1NP_001163126.1 Peptidase_C48 66..204 CDD:304959 37/154 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12606
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.