DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and Ulp1

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_573362.1 Gene:Ulp1 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster

Alignment Length:411 Identity:169/412 (41%)
Similarity:229/412 (56%) Gaps:65/412 (16%)


  Fly    22 CQDYPMAKTMPVL--KQPENFQEQEEDVVMAVQEKLKFFRKLTSNGPAVPTPLKVVEKEDIGHKE 84
            |.....:.|.|:|  ..||..:..|.:......|.    .:...|....||..:           
  Fly  1147 CSTCSSSDTEPMLVKDSPEVKEANEANEANEANEA----NETKENDAPQPTTTR----------- 1196

  Fly    85 IPKVVKKVDRKTKLLQAIPAVFKHSHNRRFRRSLFLRSNYIEQFRRWTDQKNKLNRKRLNEAHQL 149
                :||.|            |.|   |||...:|||:::.|.|      |.:.||::|...|.|
  Fly  1197 ----IKKPD------------FLH---RRFANCIFLRNDFAENF------KARANRRQLESMHLL 1236

  Fly   150 CL------KAKHERIACEIDRYKKL--ILKQS---------VHVIE--DIRISSELIPLTKEHHD 195
            .:      ::|.||:|.|    |||  ::.:|         :..:|  :.:..::|||||||.|.
  Fly  1237 GIAEQQANESKDERLAYE----KKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHA 1297

  Fly   196 RLMELSKYPLQQVIVAKFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAM 260
            |..|::...:...::.|:||.|...||.....|.||||.||||||::|.||||||.|.:|:.|||
  Fly  1298 RFQEMTTIEVTTNLIFKYNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERSEKRAGELPATYAM 1362

  Fly   261 STFFVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDP 325
            :|||:|||||:|:.||:||||||||||.|:|.||||...||||:.||.|..||:.||:|.||.:.
  Fly  1363 NTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQ 1427

  Fly   326 NLMRALVKYLQMESEDKLGLCLDTSEFRIEDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSK 390
            ..:.||||||..||.||.....|.:.|.:|:|||:|:|.|.:|||||.||||||:|||.|||||:
  Fly  1428 PALDALVKYLHEESLDKRKQPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQ 1492

  Fly   391 KDMKYFRTKMVLELTGDQLWK 411
            .:|.||||||.||:...:||:
  Fly  1493 AEMLYFRTKMALEIADGKLWQ 1513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 107/170 (63%)
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 110/175 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131090184
eggNOG 1 0.900 E1_COG5160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2988
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 P PTHR12606
RoundUp 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.