DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and CG12717

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001285167.1 Gene:CG12717 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster

Alignment Length:337 Identity:83/338 (25%)
Similarity:119/338 (35%) Gaps:108/338 (32%)


  Fly   101 AIPAVFKHSHNRRFRRSLFLRSNYIEQFRRWTDQKNKLNRKRLNEAHQLCLKAKHERIACEIDRY 165
            |||...:.:...|.||:           |.|.     |:|....:|..|......|..|.     
  Fly   310 AIPTPAERAERSRLRRN-----------RNWI-----LSRDVDEDAVVLVSSGDEETTAA----- 353

  Fly   166 KKLILKQSVHVIEDIRISSELIPLTKEHHDRLMELSKYPLQQVIVAKFNLDICGSDIKILTSGGW 230
                        :|.:....|.|      |....|..||    ......|.|...|...|:.|.:
  Fly   354 ------------DDGQTERRLSP------DENQTLFTYP----PTGTGGLSITIKDFMCLSKGSY 396

  Fly   231 LNDKIINFYM-----NLLVERSEKRPGTVPSVYAMSTFFVPRL-------------LQSGFDGVK 277
            |||.||:||:     |::.|....|      .:..||||..||             .|...:.|:
  Fly   397 LNDIIIDFYLRWLKNNIIPEEQRDR------THIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVE 455

  Fly   278 RWTRKVDLFSMDLILVPVHQMLVHWCLVII---------------------DLPAK-------TM 314
            :|||.|::|..|.|::|.::. .||.|.||                     |:|.|       ..
  Fly   456 KWTRNVNIFDKDFIIIPFNEQ-SHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILIFDS 519

  Fly   315 LYYNSRGRGDPNLMRALVKYLQMESEDKLGLCLDTSEFRIED----AQNVPQQDNMNDCGVFVCM 375
            |...||.|.    :..|..||..|.:.|....| ...|..::    :..||||.|:.|||:::..
  Fly   520 LAVTSRHRA----IAILRDYLTCEHKAKYPNAL-AHVFNKDNMPGHSVEVPQQQNLTDCGLYLLQ 579

  Fly   376 FAE-YLTRDAPI 386
            :.| :.|:  ||
  Fly   580 YVEQFFTK--PI 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 57/209 (27%)
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 3/9 (33%)
Peptidase_C48 396..585 CDD:304959 54/201 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.