DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and Senp5

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001344016.1 Gene:Senp5 MGIID:2443596 Length:749 Species:Mus musculus

Alignment Length:436 Identity:108/437 (25%)
Similarity:191/437 (44%) Gaps:107/437 (24%)


  Fly    21 ECQDYPMAKTMPVLKQP--ENFQEQEEDVVMAVQEKLKFFRKLTSNGPAVPTPLKVVEKEDIGHK 83
            ||.:  ....:|:::.|  :.|..:.|..:||:.::        |...||..     ::|.:...
Mouse   362 ECTE--QIHEIPLMEHPSSDKFSPETERALMALGQE--------SGTSAVSD-----DREKLPVS 411

  Fly    84 EIPKVVKKVDRKTKLLQAIPAVFKHSHNRRFRRSLFLRSNYIEQFRRWTD---QKNKLNRKRLNE 145
            ...|.|..||.        |...:.:.|              |.|:...|   :::.|:.|.|: 
Mouse   412 GADKSVSSVDG--------PVSEEPAQN--------------ENFQMEEDGSLKQSILSSKLLD- 453

  Fly   146 AHQLCLKAKHERIACEIDRYKKLI----LKQSVHVIEDIRISS--------------ELIPLT-K 191
             |..|.......:.|...:.:..:    ..|:...::|.::|:              .|:||: |
Mouse   454 -HPYCKSPLDAPLLCSEPKVENQMSGGKSSQTASPVDDEQLSTCLSGFLDEVMKKYGSLVPLSEK 517

  Fly   192 EHHDRL----------------MELSKYPLQ------QVIVAKFNLDICGSDIKILTSGGWLNDK 234
            :...||                .|::.|..:      ::...|..||:  .|:..|....||||:
Mouse   518 DVLGRLKDVFNEDFSNRKPFINREITNYRARHQKCNFRIFYNKHMLDM--DDLATLDGQNWLNDQ 580

  Fly   235 IINFYMNLLVERSEKRPGTVP-SVYAMSTFFVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQM 298
            :||.|..|:::       .|| .|:..::||..:|:..|::||||||:|||||...|:|:|:| :
Mouse   581 VINMYGELIMD-------AVPDKVHFFNSFFHRQLVTKGYNGVKRWTKKVDLFKKSLLLIPIH-L 637

  Fly   299 LVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQMESEDKLGLCLDTSEFRIEDAQN---- 359
            .|||.|:.:.|.::.:.:|:|:|......:..:.|||..|:.:|     :..|| ::..|.    
Mouse   638 EVHWSLITVTLSSRIISFYDSQGIHFKFCVENIRKYLLTEAREK-----NRPEF-LQGWQTAVTK 696

  Fly   360 -VPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMVLEL 404
             :|||.|.:||||||..:.:.|..:.|..||::||...|.::..||
Mouse   697 CIPQQKNDSDCGVFVLQYCKCLALEQPFQFSQEDMPRVRKRIYKEL 742

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 63/176 (36%)
Senp5NP_001344016.1 Protease 557..718 61/177 (34%)
Peptidase_C48 575..747 CDD:308514 65/183 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.