DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and RGD1561410

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_002727001.1 Gene:RGD1561410 RGDID:1561410 Length:205 Species:Rattus norvegicus

Alignment Length:205 Identity:87/206 (42%)
Similarity:135/206 (66%) Gaps:5/206 (2%)


  Fly   207 QVIVAKFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQS 271
            ||:...||:.|..:|::.|:...||||.:|||||||||:|::.:  ..|:::|.:|||..:|...
  Rat     3 QVLSCAFNMTITRADMRTLSDSAWLNDNVINFYMNLLVDRNQTQ--GYPALHAFNTFFYTKLKSG 65

  Fly   272 GFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQ 336
            |:..|:|||:.|:||:.:||||||| :.|||.||:.||..|:::|.:|.|...|:::..:..|||
  Rat    66 GYRSVRRWTKAVNLFAKELILVPVH-LDVHWSLVVTDLREKSIVYLDSMGHKRPDVLELIFHYLQ 129

  Fly   337 MESEDKLGLCLDTSEFR--IEDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTK 399
            .||:.:..:.|:.||::  ....:.:|||.|..|||||.|.:|:|::|..|||||::.|..||.:
  Rat   130 DESKARRHVDLNPSEWKQYSMPTEKIPQQGNDRDCGVFTCKYADYISRGCPITFSQQHMPLFRKR 194

  Fly   400 MVLELTGDQL 409
            ||.|:....|
  Rat   195 MVWEILHQSL 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 76/172 (44%)
RGD1561410XP_002727001.1 Peptidase_C48 <10..200 CDD:304959 83/193 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.