DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and SENP1

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_016874718.1 Gene:SENP1 HGNCID:17927 Length:707 Species:Homo sapiens

Alignment Length:393 Identity:121/394 (31%)
Similarity:202/394 (51%) Gaps:79/394 (20%)


  Fly    36 QPENF-----QEQEEDVVMAVQEKLKFFRKLTSNGPAVPTPLKVVEKEDIGHKEIPKVVKKVDRK 95
            ||:|.     |.:..|.|:.::.|          ....|||.....:.::..||:..|       
Human   364 QPDNLAASNTQSEGSDSVILLKVK----------DSQTPTPSSTFFQAELWIKELTSV------- 411

  Fly    96 TKLLQAIPAVFKHSHNRRFRRSLFLRSNYIEQFRRWTDQKN---KLNRKRLNEAHQLCLKAKHER 157
                          ::.|.|          |:.|:..:||.   :|..:||.|        :...
Human   412 --------------YDSRAR----------ERLRQIEEQKALALQLQNQRLQE--------REHS 444

  Fly   158 IACEIDRYKKLILKQSV------------HVIEDIRISSELIP-LTKEHHDRLMELSKYPLQ-QV 208
            :...::.:.::.|::.:            |.:.|   |.:..| :|:|....:..:.:...| :|
Human   445 VHDSVELHLRVPLEKEIPVTVVQETQKKGHKLTD---SEDEFPEITEEMEKEIKNVFRNGNQDEV 506

  Fly   209 IVAKFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQSGF 273
            :...|.|.|...||:.|....||||:|||||||:|:|||:::  .:|||:|.:|||..:|..:|:
Human   507 LSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEK--GLPSVHAFNTFFFTKLKTAGY 569

  Fly   274 DGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQME 338
            ..|||||:|||:||:|::|||:| :.|||||.::|...|.:.||:|.|..:....|.|::||:.|
Human   570 QAVKRWTKKVDVFSVDILLVPIH-LGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQE 633

  Fly   339 SEDKLGLCLDTSEFRI--EDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMV 401
            |.||.....||:.:::  :.:|.:|||.|.:|||:|.|.:|:.:|:|.||.|:::.|.|||.:||
Human   634 SIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMV 698

  Fly   402 LEL 404
            .|:
Human   699 WEI 701

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 80/172 (47%)
SENP1XP_016874718.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T130206
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.759 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1601
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.