DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and Senp7

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_006248306.1 Gene:Senp7 RGDID:1305510 Length:1043 Species:Rattus norvegicus

Alignment Length:446 Identity:91/447 (20%)
Similarity:162/447 (36%) Gaps:129/447 (29%)


  Fly    38 ENFQEQEEDVVMAVQEKLKFFRKLTSNGPAVPTPLKVVEKEDIGHKEIPKVVKKVDRKTKLLQAI 102
            ::.|.|.|:.:::.|.|...|..|..|.|       :.::|::..|:|...:...:.:.:|...:
  Rat   593 QDIQTQLENPMLSQQSKANEFIFLELNSP-------ISQREELKLKDIMMEIGATNGELQLSCPL 650

  Fly   103 PAVFKHSHNRRFRRSLFLRSNYIEQFRRWTDQKNKLNRKRLNEAHQLCLKAKHERIACEIDRYKK 167
            |                    :::.|..:.|    |:.:.::..|..|..|.........|..||
  Rat   651 P--------------------WVQAFPLFQD----LSPQEISFLHYYCASASSFPAVAGADMKKK 691

  Fly   168 L--------ILKQSVHVIEDIRISSELIPLTKEHHDRLMEL-SKYPLQQVIV-----AKFNLDIC 218
            .        ::|.:...:.........:.:|....:...|: :..|:|::||     .|..|.:.
  Rat   692 PVSQPSNADVVKPTYTFLHKQSSGCYSLSITSSPDEEWREVRNTGPVQKLIVYPPPPTKGGLGVT 756

  Fly   219 GSDIKILTSGGWLNDKIINFYMN-LLVERSEKRPGTVPSVYAMSTFFVPRL-------------- 268
            ..|::.|..|.:|||.||:||:. ||:|::...  .|...:..|:||...|              
  Rat   757 NEDLECLEEGEFLNDVIIDFYLKYLLLEKASDE--LVERSHIFSSFFYKCLTRKENNLTEDNPDL 819

  Fly   269 --LQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYY-------------- 317
              .|.....|:.|||.:::|:.|.|.|||::. .||.|.:|..|......|              
  Rat   820 SVAQRRHRRVRTWTRHINIFNKDYIFVPVNES-SHWYLAVICFPWLEEAVYEDFPQTVSQEFQDQ 883

  Fly   318 -----NSRGRGDP--------------------------------------------NLMRALVK 333
                 |.....||                                            |.::.|.:
  Rat   884 QSQHDNKTIDNDPHTTSTVFTSAEESQSTETSMSVPKKMCKRPCILILDSLKAASIQNTVQNLRE 948

  Fly   334 YLQMESEDKLGLCLDTSEFRIED-AQNVPQQDNMNDCGVFVCMFAEYLTRDAPITF 388
            ||::|.|.|.....:.|:..:.| ...||:|||.:||||::..:.|...:|..:.|
  Rat   949 YLEVEWEVKRKTHREFSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNF 1004

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 56/241 (23%)
Senp7XP_006248306.1 Peptidase_C48 767..1004 CDD:304959 55/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.