| Sequence 1: | NP_729837.1 | Gene: | CG32110 / 317858 | FlyBaseID: | FBgn0052110 | Length: | 411 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_056485.2 | Gene: | SENP3 / 26168 | HGNCID: | 17862 | Length: | 574 | Species: | Homo sapiens |
| Alignment Length: | 275 | Identity: | 80/275 - (29%) |
|---|---|---|---|
| Similarity: | 141/275 - (51%) | Gaps: | 29/275 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 143 LNEAHQLCLKAKHERIACEIDRYKKLI---LKQSVHVIEDIRISSELIPLTKEHHDRLMELSKYP 204
Fly 205 LQQVIVAKFNLD-----ICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVP-SVYAMSTF 263
Fly 264 FVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLM 328
Fly 329 RALVKYLQMESEDKLGLCLDTSEF----RIEDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFS 389
Fly 390 KKDMKYFRTKMVLEL 404 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32110 | NP_729837.1 | Peptidase_C48 | 230..400 | CDD:280975 | 60/174 (34%) |
| SENP3 | NP_056485.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..125 | ||
| Nuclear localization signal. /evidence=ECO:0000255 | 125..128 | ||||
| Nuclear localization signal. /evidence=ECO:0000255 | 153..159 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..181 | ||||
| Protease | 386..543 | 56/169 (33%) | |||
| Peptidase_C48 | 400..572 | CDD:280975 | 62/181 (34%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165145972 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5160 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1480705at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR12606 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1601 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 6 | 5.880 | |||||