DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and SENP3

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_056485.2 Gene:SENP3 HGNCID:17862 Length:574 Species:Homo sapiens

Alignment Length:275 Identity:80/276 (29%)
Similarity:141/276 (51%) Gaps:29/276 (11%)


  Fly   143 LNEAHQLCLKAKHERIACEIDRYKKLI---LKQSVHVIEDIRISSELIPLTKEHHDRLMELSKYP 204
            |.|.|..|:::..:..   :..|..||   ..:.|..:|||.......|..|....:|::..:..
Human   309 LREEHVTCVQSILDEF---LQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRM 370

  Fly   205 LQQVIVAKFNLD-----ICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVP-SVYAMSTF 263
            ....:|..|.:.     :...|:..|....||||:::|.|.:|:::       ||| .|:..::|
Human   371 PGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMD-------TVPEKVHFFNSF 428

  Fly   264 FVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLM 328
            |..:|...|:|||||||:.||:|:.:|:|:|:| :.|||.|:.:|:..:|:.|::|:...:....
Human   429 FYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIH-LEVHWSLISVDVRRRTITYFDSQRTLNRRCP 492

  Fly   329 RALVKYLQMESEDKLGLCLDTSEF----RIEDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFS 389
            :.:.||||.|:..|     |..:|    :.....||.:|:|.:|||.||..:.::|....|.:|:
Human   493 KHIAKYLQAEAVKK-----DRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFT 552

  Fly   390 KKDMKYFRTKMVLEL 404
            ::||...|.::..||
Human   553 QQDMPKLRRQIYKEL 567

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 60/175 (34%)
SENP3NP_056485.2 Nuclear localization signal. {ECO:0000255} 125..128
Nuclear localization signal. {ECO:0000255} 153..159
Protease 386..543 56/170 (33%)
Peptidase_C48 400..572 CDD:280975 62/182 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106177192
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1601
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.