DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and SENP6

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_056386.2 Gene:SENP6 HGNCID:20944 Length:1112 Species:Homo sapiens

Alignment Length:387 Identity:86/388 (22%)
Similarity:150/388 (39%) Gaps:117/388 (30%)


  Fly    15 FDLITKECQDYPMAKTMPVLKQPENFQEQEEDVVMAVQEKLKFFRKLTSNGPAVPTPLKVVEKED 79
            ||.:...|:...:.....:|.:|         |:..:.     |.|:..:.|. ..|::::    
Human   440 FDSVILNCRSIRVGTLFRLLIEP---------VIFCLD-----FIKIQLDEPD-HDPVEII---- 485

  Fly    80 IGHKEIPKV----VKKVDRKTKLLQAIPAVFKHSHNRRFRRSLFLRSNYIEQFRRWTDQK--NKL 138
            :...::.|.    |:|:  ....|||||||::       :.|:.|:.|  ::.:.|.|.|  |||
Human   486 LNTSDLTKCEWCNVRKL--PVVFLQAIPAVYQ-------KLSIQLQMN--KEDKVWNDCKGVNKL 539

  Fly   139 NRKRLNEAHQLCL------------------------------------KAKHERIACEIDRYKK 167
            .  .|.|.:.:.:                                    :|....:|| ...|::
Human   540 T--NLEEQYIILIFQNGLDPPANMVFESIINEIGIKNNISNFFAKIPFEEANGRLVAC-TRTYEE 601

  Fly   168 LI---LKQSVHVIEDIRISSELIPLTKEHHDRLMELSKY---------PLQQVIV-----AKFNL 215
            .|   ..|..:.|:.:...|::...:|:......|..:.         |::::||     ||..:
Human   602 SIKGSCGQKENKIKTVSFESKIQLRSKQEFQFFDEEEETGENHTIFIGPVEKLIVYPPPPAKGGI 666

  Fly   216 DICGSDIKILTSGGWLNDKIINFYMNLLV-ERSEKRPGTVPSVYAMSTFFVPRL----------- 268
            .:...|:..|..|.:|||.||:||:..|| |:.:|.  ....::..|:||..||           
Human   667 SVTNEDLHCLNEGEFLNDVIIDFYLKYLVLEKLKKE--DADRIHIFSSFFYKRLNQRERRNHETT 729

  Fly   269 ---LQSGFDG-VKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPN 326
               :|....| ||.|||.||:|..|.|.||::: ..||.|.::..|......|      :||
Human   730 NLSIQQKRHGRVKTWTRHVDIFEKDFIFVPLNE-AAHWFLAVVCFPGLEKPKY------EPN 784

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 37/114 (32%)
SENP6NP_056386.2 Protease 666..1112 40/129 (31%)
Peptidase_C48 680..>825 CDD:304959 37/115 (32%)
Peptidase_C48 <973..1049 CDD:304959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.