DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and ulp2

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_593475.2 Gene:ulp2 PomBaseID:SPAC17A5.07c Length:638 Species:Schizosaccharomyces pombe

Alignment Length:278 Identity:70/279 (25%)
Similarity:116/279 (42%) Gaps:56/279 (20%)


  Fly   183 SSELIPLTKEHHDRLMELSKYPLQQVIVAKF----NLDICGSDIKILTSGGWLNDKIINFYMN-L 242
            |::...|..:..|:.: ||......::|..|    ::.|..:|:..|..|.:|||.|::||:. |
pombe   312 SNDFSTLCSQGSDKTL-LSDASCTTILVYPFSGTNSIAITNTDLTRLNEGEFLNDTIVDFYLRYL 375

  Fly   243 LVERSEKRPGTVPSVYAMSTFFVPRLLQS-------GFDGVKRWTRKVDLFSMDLILVPVHQMLV 300
            ..:...:.|......:..:|||..||...       |..||::||:|||||....|:||:::.. 
pombe   376 YCKLQTQNPSLANDTHIFNTFFYNRLTSKDKDGKRLGHRGVRKWTQKVDLFHKKYIIVPINETF- 439

  Fly   301 HWCLVIID-----LPAKT--------------------------------MLYYNSRGRGDPNLM 328
            ||.|.||.     :|..|                                :|.::|........:
pombe   440 HWYLAIICNIDRLMPVDTKLEEQDEIVMSSVEQPSASKTRQAELTSNSPAILIFDSLANLHKGAL 504

  Fly   329 RALVKYLQMESEDKLGLCLDTSEFRIEDAQNVPQQDNMNDCGVFVCMFAE-YLTRDAPITFSKKD 392
            ..|.:||..|:.::..:.|.:::.|...|: ||||.|.:|||::...|.| :|.....:..:..|
pombe   505 NYLREYLLEEAFERKNVHLKSTDIRGFHAK-VPQQSNFSDCGIYALHFVELFLETPEQVIANTLD 568

  Fly   393 MKYFRTKMVLELTGDQLW 410
            ....||.   ....||.|
pombe   569 KSLRRTD---AKNFDQQW 583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 56/216 (26%)
ulp2NP_593475.2 ULP1 25..592 CDD:227489 70/279 (25%)
EB1_binding <230..312 CDD:283565 70/279 (25%)
Peptidase_C48 361..595 CDD:280975 59/229 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.