DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and ulp1

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_595975.1 Gene:ulp1 PomBaseID:SPBC19G7.09 Length:568 Species:Schizosaccharomyces pombe

Alignment Length:393 Identity:103/394 (26%)
Similarity:169/394 (43%) Gaps:100/394 (25%)


  Fly   104 AVFKHSHNRRFRRSLFLRSNYIEQFR---------RWTDQKNKLNRKRLNEAHQLCLKAKHERIA 159
            ||||.:.:........:.::.|..|.         .:|:.....|...:....||.:.::|.   
pombe   190 AVFKETTSSTLSHGNSVEADEINSFNPTPFSSSPLHFTNSSPNPNSDIVTPDKQLDVVSEHA--- 251

  Fly   160 CEIDRYKKL-----ILKQSVH----------------------VIEDIRISSELIPLTKEHHDRL 197
                |||.|     :.|:|.|                      |..||:....|:.|.::..::.
pombe   252 ----RYKHLPFTATLRKKSPHDSTSRKASFRFVQSDQQPARNIVTSDIQNEKSLLLLIRDLKEKQ 312

  Fly   198 -----------------MELSKYPLQ------------------------------QVIVAKFNL 215
                             :|:|..|.:                              :.|:.|||:
pombe   313 TESFQDWNEVDFLQLKGLEISPPPTRPKFIPELEFPDNARKRALKYLNQSNSVSSSEPIITKFNI 377

  Fly   216 DICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQSGFDGVKRWT 280
            .|...|:..|.:..||||::|||||||:.||| |...::|.|:..:|||...|.:.|:.||:||.
pombe   378 PITLKDLHTLRNRQWLNDEVINFYMNLISERS-KIDSSLPRVHGFNTFFYTSLQRRGYAGVRRWA 441

  Fly   281 RK--VDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVK-YLQMESEDK 342
            :|  |::..||.:.:||| :.||||:.:|:...|...|::|.. |.|..:..|:: |...|::. 
pombe   442 KKARVNIADMDAVFIPVH-LDVHWCMAVINKSKKRFEYWDSLA-GSPGKVFDLLRDYYIAETKG- 503

  Fly   343 LGLCLDTSEFRIEDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMVLELTGD 407
               .:|.|::......|.|:|.|.:|||||.|..||.::|:.|:.||:.||...|.||...:...
pombe   504 ---AVDVSDWENFMDDNSPRQRNGHDCGVFACKTAECVSRNVPVQFSQNDMPELRIKMAASIIDA 565

  Fly   408 QLW 410
            |::
pombe   566 QIY 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 68/173 (39%)
ulp1NP_595975.1 ULP1 1..568 CDD:227489 103/392 (26%)
Peptidase_C48 391..562 CDD:280975 69/178 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T631580
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1601
TreeFam 1 0.960
76.900

Return to query results.
Submit another query.