DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32110 and Semp2l2a

DIOPT Version :9

Sequence 1:NP_729837.1 Gene:CG32110 / 317858 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_694733.3 Gene:Semp2l2a / 231201 MGIID:2667157 Length:502 Species:Mus musculus


Alignment Length:246 Identity:98/246 - (39%)
Similarity:153/246 - (62%) Gaps:21/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 ISSELIPLTKEHHDRLME----------------LSKYPLQQVIVAKFNLDICGSDIKILTSGGW 230
            :::|..|:|.:...|.|:                |...|.::::.::|.|.|...||:.|.:|.|
Mouse   259 LAAEKKPITDQGKGRKMDQILDISEDMEKEIENALGPGPQEEILSSRFKLQISRGDIQTLENGQW 323

  Fly   231 LNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQSGFDGVKRWTRKVDLFSMDLILVPV 295
            |||::|||||||||||:|.:  ..|:::..||||.|:|..||:..||||||.::||..:|||||:
Mouse   324 LNDEVINFYMNLLVERNENQ--GYPALHVFSTFFYPKLKHSGYSSVKRWTRGINLFEKELILVPI 386

  Fly   296 HQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQMESEDKLGLCLDTSEFR--IEDAQ 358
            ||. |||.||:|||..::::|.:|.|:...::...:.:|||.||:.:..:.||..|::  ...::
Mouse   387 HQR-VHWSLVVIDLRKRSIVYLDSMGQTGKSICETIFQYLQNESKTRRNIELDPLEWKQCSVTSE 450

  Fly   359 NVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMVLELTGDQL 409
            .:|.|.|.:|||||.|.:|:|:.||.|:|||::.|..||.:||.|:...||
Mouse   451 EIPLQLNGSDCGVFTCKYADYIARDQPVTFSQQHMPTFRKRMVWEILHSQL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 79/171 (46%)
Semp2l2aNP_694733.3 Peptidase_C48 <279..497 CDD:304959 91/220 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836050
Domainoid 1 1.000 189 1.000 Domainoid score I3284
eggNOG 1 0.900 - - E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1480705at2759
OrthoFinder 1 1.000 - - FOG0000698
OrthoInspector 1 1.000 - - mtm8739
orthoMCL 1 0.900 - - OOG6_130490
Panther 1 1.100 - - O PTHR12606
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X425
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.710

Return to query results.
Submit another query.