DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and ulp-2

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_494914.1 Gene:ulp-2 WormBaseID:WBGene00006737 Length:893 Species:Caenorhabditis elegans

Alignment Length:215 Identity:55/216 (25%)
Similarity:91/216 (42%) Gaps:60/216 (28%)


  Fly   221 DIKILTSGGWLNDKIINFYMNLL--VERSEKRPGTVPSVYAMSTF-------FVP---------- 266
            |||.|....:|||.::.|.:|.:  :..||    .:.||:..:||       .:|          
 Worm   545 DIKTLDRKEFLNDSVMAFMLNYIAFMLSSE----LMKSVHMCNTFLFVNLTRLLPPLCFSKRRPI 605

  Fly   267 -----RLLQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLV--------IIDL--------- 309
                 ::::.....|.|||||.|:.:.|.|::|:::.| ||.::        |:|:         
 Worm   606 EPEHIKIVKDNCPRVLRWTRKFDVLAKDYIIIPINEDL-HWLVIAVINPSGAIVDMSNEEASRAA 669

  Fly   310 PAKTMLYYNSRGRGDP---NLMRALVK-YLQ----------MESEDKLGLCLDTSEFRIEDAQNV 360
            |...:::::.....||   |.|...:| ||.          |:...|.....|.....:..|:|.
 Worm   670 PKCYIVFFDPLSGLDPSKKNHMCHCIKIYLAQLYENTKAPGMKFASKNPTIYDEERVVVTRAENT 734

  Fly   361 PQQDNMNDCGVFVCMFAEYL 380
            |.|||..|||::|..|.|.|
 Worm   735 PIQDNFYDCGLYVLHFIEGL 754

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 51/207 (25%)
ulp-2NP_494914.1 Peptidase_C48 553..771 CDD:280975 51/208 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2988
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.