DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and 4930444G20Rik

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_444494.1 Gene:4930444G20Rik MGIID:2149738 Length:495 Species:Mus musculus

Alignment Length:445 Identity:133/446 (30%)
Similarity:206/446 (46%) Gaps:89/446 (20%)


  Fly    26 PMAKTMPVLKQPENFQEQEEDVVMAVQEKLKFFRKLTSNGPAVPTPLKVVEK-EDIGHKEIPKVV 89
            |..||...|:..|..:...|.||..        ||....|.....|..|:|: |....||     
Mouse    78 PQGKTPKQLEPLELTEGSPEQVVTG--------RKPADGGKGHKRPYSVMEENEQSPQKE----- 129

  Fly    90 KKVDRKTKLLQAIPAVFKHSHNRRFRRSLFLRSNYIEQFRRWTDQKNKLNRKRLNEAHQL----- 149
             |..|..:.||....|....|    |...||.:.       |..:..:....|.:|..|.     
Mouse   130 -KYGRLLQHLQCDQDVSSDPH----RPHPFLTNT-------WKIKGGESEDSRGSERTQSDREPS 182

  Fly   150 -------CLKAKHERIACEIDR---YKKLILK----------------QSVHVIEDIR------- 181
                   ||..:.....|..::   .||..:|                |:..:::..:       
Mouse   183 TVVALKECLSPEEREKCCSEEKCVTEKKDCIKGEGRRGNSLEPDLPGTQAQIILDSGKGNSLFPN 247

  Fly   182 ----ISSELIPLTKEHHDRLME----------------LSKYPLQQVIVAKFNLDICGSDIKILT 226
                :::|..|:|.....|.|:                |...|.::::.::|.|.|...||:.|.
Mouse   248 KVAVLAAEKKPITDRGKGREMDQILDITEDMEKEIENALGPGPQEEILSSRFKLQISRGDIQTLE 312

  Fly   227 SGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQSGFDGVKRWTRKVDLFSMDLI 291
            :|.||||::|||||||||||:|.:  ..|:::..||||.|:|...|:..||||||.::||..:||
Mouse   313 NGQWLNDEVINFYMNLLVERNENQ--GYPALHVFSTFFYPKLKHGGYSSVKRWTRGINLFEKELI 375

  Fly   292 LVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQMESEDKLGLCLDTSEFR--I 354
            |||:||. |||.||:|||..::::|.:|.|:...::...:.:|||.||:.:..:.||..|::  .
Mouse   376 LVPIHQR-VHWSLVVIDLRKRSIVYLDSMGQTGKSICETIFQYLQNESKTRRNVELDPLEWKQYS 439

  Fly   355 EDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMVLELTGDQL 409
            ..::.:|.|.|.:|||:|.|.:|:|:.||.|:|||::.|..||.:||.|:...||
Mouse   440 VTSEEIPLQLNGSDCGMFTCKYADYIARDQPVTFSQQHMPTFRKRMVWEILHSQL 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 77/172 (45%)
4930444G20RikNP_444494.1 Peptidase_C48 <272..490 CDD:304959 89/221 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T130979
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.794 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.880

Return to query results.
Submit another query.