DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and LOC103692995

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_017458985.1 Gene:LOC103692995 RGDID:9174101 Length:697 Species:Rattus norvegicus

Alignment Length:408 Identity:125/409 (31%)
Similarity:205/409 (50%) Gaps:83/409 (20%)


  Fly    36 QPE-----NFQEQEEDVVMAVQEKLKFFRKLTSNGPA--VPTPLKVVEKEDIGHKEIPKVVKKVD 93
            ||:     |.|.:..|.|:.::.|       .|..||  ..:|||        ....|.:: ...
  Rat   328 QPDSLPASNPQSEGSDSVILLKVK-------ESQTPASRYLSPLK--------RSTCPYII-PYS 376

  Fly    94 RKTKLLQAIPAVFKHSHNRRFRRSLFLRSNYIEQFRRWTDQKNKLNRKRLNEAHQLCLKAKHERI 158
            ..|.||.:.|..|:             ...:|::.....|.:.:...:::.|...|.|:.:::| 
  Rat   377 AVTDLLSSSPTFFQ-------------AELWIKELTSVYDSRARERLRQIEEQKALALQLQNQR- 427

  Fly   159 ACEIDRYKKLILKQSVHVIED-----IRISSEL-IPLT------KEHHDRLMELSKYP------- 204
                       |::..|.:.|     :|:..|. :|:|      |:.|.......::|       
  Rat   428 -----------LQEQEHAVLDSVELHLRVPLEKEVPVTAAQETRKKSHQLTDSEDEFPEITEEME 481

  Fly   205 -----------LQQVIVAKFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVY 258
                       ..:|:...|.|.|...||:.|....||||:|||||||:|:|||:::  ..|||:
  Rat   482 KEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEK--GFPSVH 544

  Fly   259 AMSTFFVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRG 323
            |.:|||..:|..:|:..|||||:|||:||:|::|||:| :.|||||.::|...|::.||:|.|..
  Rat   545 AFNTFFFTKLKAAGYQAVKRWTKKVDVFSVDILLVPIH-LGVHWCLAVVDFRKKSVTYYDSMGGV 608

  Fly   324 DPNLMRALVKYLQMESEDKLGLCLDTSEFRI--EDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPI 386
            :....|.|::||:.||.||.....||:.:::  :.:|.:|||.|.:|||:|.|.:|:.:|:|.||
  Rat   609 NNEACRILLQYLKQESVDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPI 673

  Fly   387 TFSKKDMKYFRTKMVLEL 404
            .|:::.|.|||.:||.|:
  Rat   674 NFTQQHMPYFRKRMVWEI 691

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 80/172 (47%)
LOC103692995XP_017458985.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.