DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and LOC101733270

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_012810891.1 Gene:LOC101733270 ID: Length:377 Species:Xenopus tropicalis

Alignment Length:104 Identity:20/105 (19%)
Similarity:42/105 (40%) Gaps:17/105 (16%)


  Fly   143 LNEAHQLCLKAKHERIACEIDRYKKLI---LKQSVHVIEDIRISSELIPLTK---EHHDRLMELS 201
            |.:.|..|:::..::.   :..|..||   ..:.|..:||:...|...|..:   :|  .:....
 Frog   217 LTQEHVACVQSILDQF---LQTYGSLIPLGTDEVVEKLEDVFQQSFSTPARRTVVQH--VIQSYQ 276

  Fly   202 KYPLQQVIVAKFNLD-----ICGSDIKILTSGGWLNDKI 235
            ::| ...::..|.:.     :...|:..|....||||::
 Frog   277 RHP-GNAMLRGFRVTYKRHVLSMDDLGTLYGQNWLNDQV 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 4/7 (57%)
LOC101733270XP_012810891.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.