DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and senp1

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_002933743.1 Gene:senp1 XenbaseID:XB-GENE-1014921 Length:621 Species:Xenopus tropicalis

Alignment Length:403 Identity:128/404 (32%)
Similarity:208/404 (51%) Gaps:73/404 (18%)


  Fly    23 QDYPMAKTMPVLKQPENFQEQEEDVVMAVQEKLKFFRKLTSNGPAVPTPLKVVEKEDIGHKEIPK 87
            |..|..|.:|..:     |.|..|.|:.:...:|         |.||.  :|...:...|.|:  
 Frog   275 QQLPKEKFVPTSQ-----QSQGSDSVIVLDPVVK---------PQVPG--QVPTSQPFFHAEL-- 321

  Fly    88 VVKKVDRKTKLLQAIPAVFKHSHNRRFRRSLFLRSNYIEQFRRWTDQKNKLNRKRLNEAHQLCLK 152
                                                :|::.....|.:.:..|:::.|...:.||
 Frog   322 ------------------------------------WIKELTSLFDSRARERRRQIEEQKAVALK 350

  Fly   153 AKHERI-AC----EIDRYKKLILKQSVHVI-----EDIRISSELI--PLTKEHHDRLMELSKY-- 203
            .:.:|: .|    .||.:.::.|::.:.|.     ||....||.|  |...|..:|.::.:.:  
 Frog   351 LQKQRLQECSVQDSIDLHLRVPLEKEIPVTLIQKQEDESTQSEEIEFPELTEAMEREIKRALFGG 415

  Fly   204 PLQQVIVAKFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRL 268
            ...|.:...:.|.|...||..|.|..||||:||||||||::||| ||.| :|.|:|.:|||..:|
 Frog   416 SQDQTLSEGYRLTITRKDIMTLHSLNWLNDEIINFYMNLIMERS-KRKG-LPKVHAFNTFFFTKL 478

  Fly   269 LQSGFDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVK 333
            ..:|:..|||||:|||:|||:::|||:| :.|||||.::|...|::||::|.|..:....:.|::
 Frog   479 KSAGYQAVKRWTKKVDIFSMNILLVPIH-LGVHWCLAVVDFRKKSILYFDSMGGLNNEACKILLQ 542

  Fly   334 YLQMESEDKLGLCLDTSEFRI--EDAQNVPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYF 396
            ||:.||.||.|:..|::.:.:  :.::.:|||.|.:|||:|.|.:|:|:|:|..|||:::.|.||
 Frog   543 YLKQESIDKKGVSFDSNGWTLTSKTSEEIPQQMNGSDCGMFACKYADYITKDKSITFTQRHMPYF 607

  Fly   397 RTKMVLELTGDQL 409
            |.|||.|:...:|
 Frog   608 RKKMVWEILHQKL 620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 82/172 (48%)
senp1XP_002933743.1 Peptidase_C48 <355..619 CDD:304959 106/267 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.714 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.780

Return to query results.
Submit another query.