DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and senp5

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_002937875.2 Gene:senp5 XenbaseID:XB-GENE-486043 Length:725 Species:Xenopus tropicalis

Alignment Length:462 Identity:114/463 (25%)
Similarity:191/463 (41%) Gaps:146/463 (32%)


  Fly     1 MLAFEKEIVEKSRYFDLITKECQDYPMAKTMPVLKQPENFQEQEEDVVM-AVQEKLKFFRKLTSN 64
            :|..|||          ::..||            :..:.|.:|.|.:| ...:||    :|:.|
 Frog   345 ILVTEKE----------VSVSCQ------------EDTDAQGREGDELMHMAPDKL----QLSVN 383

  Fly    65 ---GPAVPTPLKVVEK-EDIGHKEIPKVVKKVDRKTKLLQAIPAVFKHSHNRRFRRSLFLRSNYI 125
               |....||:.::|. :|..|.::.:........||||.                         
 Frog   384 EHTGCQATTPVDMLENCDDSSHMDVEETTNMGVFNTKLLD------------------------- 423

  Fly   126 EQFRRWTDQKNKLNRKRLNEAHQLCLKAKHERIACEIDRYKKLI----LKQSVHVI---EDIRIS 183
                                 |..|.....:...|..:....::    ||...:||   .|.:::
 Frog   424 ---------------------HPYCKSPPQDAKDCPSEEALLMLATEGLKNGQNVISSVSDEQLA 467

  Fly   184 S--------------ELIPLT-------------KEHHDRL----MELSKYPLQ---------QV 208
            |              .||||:             ::..:|:    .|::||..:         :|
 Frog   468 SFICGLLDDIIKKYGSLIPLSEKDILTCLKDTFNEDFSNRISFISKEITKYRAKHSKAPTCNFRV 532

  Fly   209 IVAKFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVP-SVYAMSTFFVPRLLQSG 272
            ...|..||:  .|:..|....||||::||.|..|:::       .|| .|:.:::||..:|:..|
 Frog   533 FYNKHMLDM--DDLATLDGQNWLNDQVINMYGELIMD-------AVPEKVHFLNSFFHRQLVTKG 588

  Fly   273 FDGVKRWTRKVDLFSMDLILVPVHQMLVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQM 337
            ::||||||:|||.|...|:|:|:| :.|||.|:.:::|.|.:.:|:|:|......:..:.|||..
 Frog   589 YNGVKRWTKKVDFFKKSLLLIPIH-LEVHWSLITVNIPQKIISFYDSQGIHFKFCVENIRKYLLT 652

  Fly   338 ESEDKLGLCLDTSEFRIEDAQN-----VPQQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFR 397
            |:.:|     :..|| ::|.|.     :|||.|.:||||||..:.:.|..|.|..||::||...|
 Frog   653 EAREK-----NHPEF-LQDWQTAITKCIPQQKNDSDCGVFVLQYCKCLALDQPFQFSQEDMPRVR 711

  Fly   398 TKMVLEL 404
            .::..||
 Frog   712 KRIYKEL 718

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 65/176 (37%)
senp5XP_002937875.2 Peptidase_C48 551..721 CDD:280975 67/183 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.