DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32110 and si:dkey-21c19.3

Sequence 1:NP_729837.1 Gene:CG32110 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_001343517.1 Gene:si:dkey-21c19.3 ZFINID:ZDB-GENE-030131-6462 Length:729 Species:Danio rerio

Alignment Length:373 Identity:125/374 (33%)
Similarity:203/374 (54%) Gaps:42/374 (11%)


  Fly    62 TSNGPAVPTPLKVVEKEDIGHKEIPK---------VVKKVDRKTKLLQAIPAVFKHSHNRRFRRS 117
            ::.||.||:.......:|...::...         .||:...|.....::|.         |:..
Zfish   372 SAKGPDVPSAPSPAALQDTSSQDTQSSAHDGDSVIFVKEQQGKKPESSSVPC---------FQAE 427

  Fly   118 LFLRSNYIEQFRRWTDQKNKLNRKRLNEAHQLCLKAKHERIACE-------IDRYKKLILKQSVH 175
            |     :|::.....|.:.:..|:.:.|...|..:...:|::.|       ::...::.|::.|.
Zfish   428 L-----WIKELTSLYDSRARERRRLIEEQEALASQLLRQRLSGEGRASPASVELKVRVPLEKEVP 487

  Fly   176 VI------EDIRISSELIPLTKEHHDRLMELSKYPLQQVIVAK-FNLDICGSDIKILTSGGWLND 233
            :.      :.|:...|...||:|..:.:....:...|..|::: |.|.|...|::.|:...||||
Zfish   488 IAAVIKKPQPIKEEPEFPELTEEMENDVSRALRGGSQDEILSEGFRLTITRKDLQTLSHLNWLND 552

  Fly   234 KIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQSGFDGVKRWTRKVDLFSMDLILVPVHQM 298
            ::|||||||||||| |:| .:||.|..:|||.|:|..||:..|:|||:|||:||:|||||||| :
Zfish   553 EVINFYMNLLVERS-KQP-DLPSAYTFNTFFFPKLRSSGYSAVRRWTKKVDIFSVDLILVPVH-L 614

  Fly   299 LVHWCLVIIDLPAKTMLYYNSRGRGDPNLMRALVKYLQMESEDKLGLCLDTSEFRIEDAQ--NVP 361
            .|||||.::|...|::.|::|.|..:....|.|:.||:.|||||.|..::||.:.::..:  .:|
Zfish   615 GVHWCLSVVDFRNKSITYFDSMGGNNDEACRILLNYLKQESEDKKGQKMETSGWSLKSKRPNEIP 679

  Fly   362 QQDNMNDCGVFVCMFAEYLTRDAPITFSKKDMKYFRTKMVLELTGDQL 409
            ||.|.:|||:|.|.:|||:|:|..|||::|.|.|||.:||.|:...:|
Zfish   680 QQMNGSDCGMFTCKYAEYITKDRSITFTQKHMPYFRKRMVWEILNRKL 727

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 89/172 (52%)
si:dkey-21c19.3XP_001343517.1 Peptidase_C48 <490..726 CDD:304959 104/239 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I3591
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1480705at2759
OrthoFinder 1 1.000 FOG0000413
OrthoInspector 1 1.000 T128728
orthoMCL 1 0.900 OOG5_127954
Panther 1 1.100 O PTHR12606
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1601
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.