DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32107 and CG32115

DIOPT Version :8

Sequence 1:NP_001261789.2 Gene:CG32107 / 317856 FlyBaseID:FBgn0052107 Length:980 Species:Drosophila melanogaster
Sequence 2:NP_729854.1 Gene:CG32115 / 317862 FlyBaseID:FBgn0052115 Length:475 Species:Drosophila melanogaster

Alignment Length:559 Identity:113/560 (20%)
Similarity:214/560 (38%) Gaps:150/560 (27%)


  Fly    10 KTTIFNLNPYCLYEIFRQIHKNCAFK---QTNDIFLKYSDLINFAICCDHLNRTFKKWSLNLYKE 71
            ||.|.::|.:..:.|...:.|||..:   :|.:| :||:|::|||.......|..:.|.::.|..
  Fly     2 KTQITDINHFAFFRILDILKKNCETQHGDETEEI-IKYADILNFATASFKFTRIVRDWDIHFYTR 65

  Fly    72 LCIENTFLNTYICVEINFSNLHSHIYGLSNSEKKMFWMNFKNHIMDNEQLESLKVIYEPTRYWSD 136
            |.|....:.....:.||...::..: .....|.:...:|....|:.|..:..||:......::.:
  Fly    66 LAIHELHVVPRRNITINLDAMYKTL-NAETEEGRKHLVNIITSIVSNPSIRRLKLNNLDAFFYEE 129

  Fly   137 YLERFEDLIKSLHVKPKLRELSVYIN--GFSLEIVPQITHLEKLELNVRMHSSILVELCKLNPNL 199
            :....::::|.|.:|...:.:.:.:|  |..:..:....::.||.|...:..|.|.:.|..||.|
  Fly   130 HSSFADEILKILQLKRNSKPIELILNIPGREIRNLHGFRNISKLILTASIEISDLEKFCLYNPKL 194

  Fly   200 RRLILRNSEI--FGRLSDIVPHCNQLEYLSFVMKEVDA--SEYVALANLPQLKSLILCGEHLEGS 260
            ..|.:..|..  .|:|:.|||||:.|:.|.|::.: :|  ::||.|:.|.:|:.||         
  Fly   195 STLEVNQSHFSDHGKLAQIVPHCSNLKNLKFILDD-NAWDNDYVRLSRLNRLQKLI--------- 249

  Fly   261 LVKLFNRFQEHQHIQSICIPETYVSNAEAIALASIRLVVSIKCCLRDKSIYSDLPLSGKLTHIYI 325
                            |.:||...::.|                                  |.|
  Fly   250 ----------------ILLPENNENDME----------------------------------IDI 264

  Fly   326 LGHPMQYNPDNPYYNEKEED----FLKV----TYRAHRPL-AVVRAYYQYWQTK----------D 371
            ..|            |:|||    |.::    ||....|: .:::|.::..::.          |
  Fly   265 ESH------------EEEEDMGMYFEEIGAVSTYTRSIPIFQLLKALHEKEKSTLRELRLGFNID 317

  Fly   372 PNLLQLAFDEDYLHAHRLYCIGWYDAK-ILPATMHNSSEQFSVSITGIVLNKKVSISDAELAVLA 435
            ..::||....:.|..  |.| |:||.| :.....|.:.::.|      .|||...|:|...|:|.
  Fly   318 DEMVQLISKLNELRG--LEC-GFYDPKSVSHFVQHPNLKRLS------TLNKASIITDDYAALLE 373

  Fly   436 SIPTLTTIRCSFVQIEQIIAVKLQQLNEITNTANRVDKIKTEFCNIRFVHSHESVTLVLEFFVQC 500
            .       :|:...::..|....:  ..::....:||.:::..|               |.|:: 
  Fly   374 K-------QCTISNLDTKIIFNAK--GTLSIFTEKVDILRSGNC---------------ESFLK- 413

  Fly   501 ILSYGSILAPLANLRNLKRLEIKGKLMSGSLVELFRALA 539
                         |:|||::.:...::......|.|.||
  Fly   414 -------------LKNLKKIFVPDNMIKYEKATLDRFLA 439



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140902048
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.