DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ghi and sptssb

DIOPT Version :9

Sequence 1:NP_729495.1 Gene:ghi / 317833 FlyBaseID:FBgn0266124 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_001153305.1 Gene:sptssb / 678546 ZFINID:ZDB-GENE-060421-6887 Length:80 Species:Danio rerio


Alignment Length:48 Identity:12/48 - (25%)
Similarity:30/48 - (62%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LDNLVEFASYWWFRYLMVTELYMVEKWERITIHVIFMVLFCVFWYFNY 49
            :.|:.|:.|:.:::||::|.:|::|.||:...:.:...:..:..|.:|
Zfish     3 MKNMREYMSWLYYQYLLITGIYVLEPWEQSIFNTVLFTMVAMVIYTSY 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ghiNP_729495.1 None
sptssbNP_001153305.1 DUF3317 7..59 CDD:288612 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1627882at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.