powered by:
Protein Alignment ghi and sptssb
DIOPT Version :9
| Sequence 1: | NP_729495.1 |
Gene: | ghi / 317833 |
FlyBaseID: | FBgn0266124 |
Length: | 81 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001153305.1 |
Gene: | sptssb / 678546 |
ZFINID: | ZDB-GENE-060421-6887 |
Length: | 80 |
Species: | Danio rerio |
| Alignment Length: | 48 |
Identity: | 12/48 - (25%) |
| Similarity: | 30/48 - (62%) |
Gaps: | 0/48 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 LDNLVEFASYWWFRYLMVTELYMVEKWERITIHVIFMVLFCVFWYFNY 49
:.|:.|:.|:.:::||::|.:|::|.||:...:.:...:..:..|.:|
Zfish 3 MKNMREYMSWLYYQYLLITGIYVLEPWEQSIFNTVLFTMVAMVIYTSY 50
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| ghi | NP_729495.1 |
None |
| sptssb | NP_001153305.1 |
DUF3317 |
7..59 |
CDD:288612 |
11/44 (25%) |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1627882at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.