powered by:
Protein Alignment ghi and sptssb
DIOPT Version :9
Sequence 1: | NP_729495.1 |
Gene: | ghi / 317833 |
FlyBaseID: | FBgn0266124 |
Length: | 81 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001153305.1 |
Gene: | sptssb / 678546 |
ZFINID: | ZDB-GENE-060421-6887 |
Length: | 80 |
Species: | Danio rerio |
Alignment Length: | 48 |
Identity: | 12/48 - (25%) |
Similarity: | 30/48 - (62%) |
Gaps: | 0/48 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 LDNLVEFASYWWFRYLMVTELYMVEKWERITIHVIFMVLFCVFWYFNY 49
:.|:.|:.|:.:::||::|.:|::|.||:...:.:...:..:..|.:|
Zfish 3 MKNMREYMSWLYYQYLLITGIYVLEPWEQSIFNTVLFTMVAMVIYTSY 50
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ghi | NP_729495.1 |
None |
sptssb | NP_001153305.1 |
DUF3317 |
7..59 |
CDD:288612 |
11/44 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1627882at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.