DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ghi and sptssa

DIOPT Version :8

Sequence 1:NP_729495.1 Gene:ghi / 317833 FlyBaseID:FBgn0266124 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_001005001.1 Gene:sptssa / 448487 XenbaseID:XB-GENE-949952 Length:80 Species:Xenopus tropicalis

Alignment Length:49 Identity:20/50 (40%)
Similarity:30/50 (60%) Gaps:15/50 (30%)


  Fly    10 SYWWFRYLMVTELYMVEKWERITIHVIFMVLFCVFWYFNYSVLLSLAGL 58
            |:.:::||:||.|||:|.||| ||             || |:|:|:.|:
 Frog    23 SWLYYQYLLVTALYMLEPWER-TI-------------FN-SMLVSIVGM 56

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ghiNP_729495.1 None
sptssaNP_001005001.1 SPT_ssu-like 19..68 CDD:314617 20/50 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1627882at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.