DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ghi and R05G9.3

DIOPT Version :8

Sequence 1:NP_729495.1 Gene:ghi / 317833 FlyBaseID:FBgn0266124 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_495314.2 Gene:R05G9.3 / 187627 WormBaseID:WBGene00019905 Length:230 Species:Caenorhabditis elegans

Alignment Length:34 Identity:6/35 (17%)
Similarity:13/35 (37%) Gaps:5/35 (14%)


  Fly    13 WFRYLMVTELYMVEKWERITIHVIFMVLFCVFWY 46
            |.|.:....:.::.     .|..|.:.|.|..::
 Worm   149 WIRRVKDFNISLIS-----VIVTIIVTLMCYLFF 177



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.