powered by:
Protein Alignment ghi and SPTSSA
DIOPT Version :9
| Sequence 1: | NP_729495.1 |
Gene: | ghi / 317833 |
FlyBaseID: | FBgn0266124 |
Length: | 81 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_612145.2 |
Gene: | SPTSSA / 171546 |
HGNCID: | 20361 |
Length: | 71 |
Species: | Homo sapiens |
| Alignment Length: | 49 |
Identity: | 18/49 - (36%) |
| Similarity: | 29/49 - (59%) |
Gaps: | 15/49 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 SYWWFRYLMVTELYMVEKWERITIHVIFMVLFCVFWYFNYSVLLSLAGL 58
|:::::||:||.|||:|.|||.. || |:|:|:.|:
Human 14 SWFYYQYLLVTALYMLEPWERTV--------------FN-SMLVSIVGM 47
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| ghi | NP_729495.1 |
None |
| SPTSSA | NP_612145.2 |
SPT_ssu-like |
10..63 |
CDD:403091 |
18/49 (37%) |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1627882at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.