DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18789 and CG18787

Sequence 1:NP_723704.1 Gene:CG18789 FlyBaseID:FBgn0042127 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_652664.2 Gene:CG18787 FlyBaseID:FBgn0042125 Length:398 Species:Drosophila melanogaster

Alignment Length:399 Identity:396/400 (99%)
Similarity:396/400 (99%) Gaps:2/400 (1%)


  Fly     1 MVVCRFFQQGSCRYGAKCNNEHFDVKQYLKADMESSLNGKMWPLSAYGPFKDKANFPNFIQDQSF 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MVVCRFFQQGSCRYGAKCNNEHFDVKQYLKADMESSLNGKMWPLSAYGPFKDKANFPNFIQDQSF 65

  Fly    66 EEVRFMCYEAKRQNQFEQFSQQFNREVLEANNKMKTMLQMSPQVLEMMIKIHETPEGGTVSAAPQ 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 EEVRFMCYEAKRQNQFEQFSQQFNREVLEANNKMKTMLQMSPQVLEMMIKIHETPEGGTVSAAPQ 130

  Fly   131 QSSNPFAAAAPAAANTSASIFGKPTLSAGNIFGNATSQASNTNSIFGGTISNANARNSIFGVGAA 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 QSSNPFAAAAPAAANTSASIFGKPTLSAGNIFGNATSQASNTNSIFGGTISNANARNSIFGVGAA 195

  Fly   196 ATGAQSVFGQPQQQQLQPAAQAFQGGNIFAQAQVQVQAQPVNPNPFGGFQQQQQQPQSTGIFGQA 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   196 ATGAQSVFGQPQQQQLQPAAQAFQGGNIFAQAQVQVQAQPVNPNPFGGFQQQQQQPQSTGIFGQA 260

  Fly   261 ASQNMGGMFTQASQQLQQQQQAAASGLFAQAAASAFPNQQQMQQQQQMQQQQQMQQQQMHQQQQM 325
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   261 ASQNMGGMFTQASQQLQQQQQAAASGLFAQAAASAFPNQQQMQQQQQMQQQQQMQQQQMHQQQQM 325

  Fly   326 QQQQMQQQQQQFQMQQQQQMM-QQQQQQAQPTNEIQSSVYSRMEDLNEQEIEAFKADQFLPGALP 389
            ||||| ||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||
  Fly   326 QQQQM-QQQQQFQMQQQQQMMQQQQQQQAQPTNEIQSSVYSRMEDLNEQEIEAFKADQFLPGALP 389

  Fly   390 FKPPPRNFC 398
            |||||||.|
  Fly   390 FKPPPRNLC 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18789NP_723704.1 ZnF_C3H1 1..22 CDD:214632 21/21 (100%)
Nucleoporin_FG 145..>204 CDD:290362 59/59 (100%)
CG18787NP_652664.2 ZnF_C3H1 1..22 CDD:214632 21/21 (100%)
Nucleoporin_FG 145..>204 CDD:290362 59/59 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C177417018
eggNOG 1 0.900 E1_28W1G
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 40 1.000 Inparanoid score I5414
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1562631at2759
OrthoFinder 1 1.000 FOG0012256
orthoMCL 1 0.900 OOG5_146491
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.