DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18789 and nupl2

Sequence 1:NP_723704.1 Gene:CG18789 FlyBaseID:FBgn0042127 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001015793.1 Gene:nupl2 XenbaseID:XB-GENE-6258607 Length:449 Species:Xenopus tropicalis

Alignment Length:540 Identity:109/541 (20%)
Similarity:156/541 (29%) Gaps:244/541 (45%)


  Fly     1 MVVCRFFQQGSCRYGAKCNNEH------------------------------------------- 22
            |.:|.||.||.||||.||.|||                                           
 Frog     1 MAICSFFLQGRCRYGEKCWNEHPRGGSSRYQSQNRYQEPPGNAKGTWGSSSQRYVQPSSFSRSTT 65

  Fly    23 ----------------FDVKQY-------------------------------------LKADME 34
                            ||.:..                                     :..|||
 Frog    66 WVNRDNEKPSSGSHSGFDNRNVKFTAATGFPSSQNRFAALSSQDNSRDAQTDKGNIIDDITNDME 130

  Fly    35 SSLNGKMWPLSAYGPFKDKANFPNFIQDQSFEEVRFMCYEAKRQ-------NQFEQFSQQFNREV 92
            ...:...|..|.|...::|.|...| .|.|.||:|...|..:.:       |..:|...::.:.:
 Frog   131 IWESSGQWMFSVYSMLREKKNISGF-ADFSPEELRLEYYACQAEGNPLKYINAVQQLGSKWKQRI 194

  Fly    93 LEANN-----KMKTMLQMSPQVLEMMIKIH--ETPEGGTVSAAPQQSSNPFAA-------AAPAA 143
            ||..|     ||....::|....:|....:  :.|..|: |:.|..::.|.||       ||.||
 Frog   195 LELKNLNPSSKMALFNELSSPSSDMTSGYNGQQKPAFGS-SSFPTNNTAPTAATFSFKADAANAA 258

  Fly   144 --------ANTSASIFG-KPTLSAGNIFGNATSQAS-----NTNSIFGGTISNA---NARNSIFG 191
                    |.::...|| |||.:.....|.|.:.||     :::|.||.|.|.:   ||.|:...
 Frog   259 KAGATNSLAGSNVPAFGNKPTSAPSFGSGGAATAASFSFAPSSSSNFGATTSTSGFGNASNTASF 323

  Fly   192 VGAAATGAQSVFGQPQQQQLQPAAQAFQGG------------NIFAQAQVQVQAQPVNPNPFGGF 244
            .|.|.:.|...||....   ..||..|.||            ::|:       |..|.|.|.   
 Frog   324 QGTANSAAAPAFGVASS---STAATGFGGGFSTTGAMNTGVRDLFS-------AGTVGPGPV--- 375

  Fly   245 QQQQQQPQSTGIFGQAASQNMGGMFTQASQQLQQQQQAAASGLFAQAAASAFPNQQQMQQQQQMQ 309
                     |.:|    .|..|.:...||......|....|.|                      
 Frog   376 ---------TSLF----VQTTGPLHATASSTSLDGQSFRPSAL---------------------- 405

  Fly   310 QQQQMQQQQMHQQQQMQQQQMQQQQQQFQMQQQQQMMQQQQQQAQPTNEIQSSVYSRMEDLNEQE 374
                                                        ..||    |:::...:|:.:|
 Frog   406 --------------------------------------------NTTN----SLFTPQNELSAEE 422

  Fly   375 IEAFKADQFLPGALPFKPPP 394
            :..|||.:|..|.:|.||||
 Frog   423 LAQFKAQRFTLGKIPLKPPP 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18789NP_723704.1 ZnF_C3H1 1..22 CDD:214632 14/21 (67%)
Nucleoporin_FG 145..>204 CDD:290362 21/68 (31%)
nupl2NP_001015793.1 ZnF_C3H1 1..24 CDD:214632 15/23 (65%)
FG 1 231..232 0/1 (0%)
FG 2 274..275 1/1 (100%)
FG 3 284..285 0/1 (0%)
FG 4 305..306 1/1 (100%)
FG 5 314..315 0/1 (0%)
FG 6 335..336 1/1 (100%)
FG 7 347..348 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C178023621
eggNOG 1 0.900 E1_28W1G
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4490
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1562631at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.