DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18789 and Nupl2

Sequence 1:NP_723704.1 Gene:CG18789 FlyBaseID:FBgn0042127 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001102687.1 Gene:Nupl2 RGDID:1560934 Length:418 Species:Rattus norvegicus

Alignment Length:507 Identity:94/508 (19%)
Similarity:142/508 (28%) Gaps:208/508 (41%)


  Fly     1 MVVCRFFQQGSCRYGAKCNNEH------------------------------------------- 22
            |.:|:||.||.||:|.:|.|||                                           
  Rat     1 MTICQFFLQGRCRFGDRCWNEHPGARGAAGARQPPPQQQPPSGGNRRGWNAGSQRYSNVIQPSSF 65

  Fly    23 ---------------------------------------------FDVKQYLKA---DMESSLNG 39
                                                         .|.|:.|:.   |:|...:.
  Rat    66 SKSTPWGGSRGQDKPPFGPFDSGASTSRGFGSPQNPFASPLSDEQKDEKKLLEGIVKDVEVWESS 130

  Fly    40 KMWPLSAYGPFKDKANFPNFIQDQSFEEVRFMCYEAKRQNQFEQF---SQQFNREVLEANNKMKT 101
            ..|..|.|.|.:.|.|...| .|.|.||:|...:.....|..:.:   .||...:.....|::|.
  Rat   131 GQWMFSVYSPVRKKPNISGF-TDISPEELRLEYHNFLTSNNLQSYLNSVQQLVNQWRSRINELKN 194

  Fly   102 MLQMSPQVLEMMIKIHETPEGGTVSAAPQQSSNPFAAAAPA--AANTSASIFGKPTLSAGNIF-- 162
             |.||                 |..|......:..:.||||  ..:..|..||.|.....|..  
  Rat   195 -LNMS-----------------TKGALLSDLKDAVSQAAPAFGFGSKQAGTFGSPGFPVNNSSST 241

  Fly   163 -----------GNATSQASNTNSIFGGTISNANARNSIFGVGAAATGAQS----VFGQPQQQQLQ 212
                       |.||:.:.|| |:||.        :..||.|.:|..|.|    .||..:.:...
  Rat   242 TVQSFSFKTSPGLATAPSGNT-SVFGS--------HPAFGAGPSAGSAVSSSIPAFGLGKPEATS 297

  Fly   213 PAAQAFQGGNIFAQAQVQVQAQPVNPNPFGGFQQQQQQPQSTGIFGQAASQNMGGMFTQASQQLQ 277
            .|:.:|:          ..:|.......|.||    ..|.:|..||.|.:...|...........
  Rat   298 AASFSFK----------SPEASSFGSPGFSGF----PAPMATSPFGPATAPAFGSSVAAFGSPSP 348

  Fly   278 QQQQAAASGLFAQAAASAFPNQQQMQQQQQMQQQQQMQQQQMHQQQQMQQQQMQQQQQQFQMQQQ 342
            ..|.     :||:.....|..                                            
  Rat   349 HSQT-----VFAKPCTDVFGG-------------------------------------------- 364

  Fly   343 QQMMQQQQQQAQPTNEIQSSVYSRMEDLNEQEIEAFKADQFLPGALPFKPPP 394
            ..:.......:.|.|    ::::..:.|.::|:|.|::.:|..|.:|.||||
  Rat   365 SSISSSVPASSAPDN----ALFTPRDQLTKEELEQFQSQKFTLGKIPLKPPP 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18789NP_723704.1 ZnF_C3H1 1..22 CDD:214632 12/21 (57%)
Nucleoporin_FG 145..>204 CDD:290362 20/76 (26%)
Nupl2NP_001102687.1 ZnF_C3H1 1..23 CDD:214632 13/22 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C178026584
eggNOG 1 0.900 E1_28W1G
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1562631at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.