DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Es2 and Ess2

DIOPT Version :8

Sequence 1:NP_572480.1 Gene:Es2 / 31780 FlyBaseID:FBgn0023506 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001012490.1 Gene:Ess2 / 360741 RGDID:1308218 Length:480 Species:Rattus norvegicus

Alignment Length:530 Identity:187/531 (35%)
Similarity:268/531 (50%) Gaps:91/531 (17%)


  Fly    12 GTPG-TPGSLAMEVARVQNSALAEFKKPTAMVRHKNKPKILTEEKYIEEMSKIIQRDFFPDLERL 75
            |||| :.|:|.:..|.......|..:...|.|. |:|.::|.||:|||.:..:||||||||:|:|
  Rat     2 GTPGVSAGALFLSSASAPPRKRAAGEAGEAGVA-KSKQRVLDEEEYIEGLQTVIQRDFFPDVEKL 65

  Fly    76 RAQNDYLDAESRRDFVQMAEIRERY--SLGRISGTGRSTSRRNNA---MSPATFETP---VSQAK 132
            :||.:||:||...|..:|.:|..::  :||:||        |...   ::|||||||   .....
  Rat    66 QAQKEYLEAEENGDLERMRQIAIKFGSALGKIS--------REPPPPYVTPATFETPEVHPGSGV 122

  Fly   133 CSNTPLPNSRATDTPFSTDGSEKSDAEGRDTTAKLSLDAFLQKYTSEDNQSFQEIIETAEAKLRQ 197
            ..:.|.|..|..:     |..|..:.|.::...  |||.||.:||||||.|||||:|.|:.|...
  Rat   123 LGSKPRPQGRDPE-----DAGEAGEEEEKEPLP--SLDVFLSRYTSEDNASFQEIMEVAKEKSHA 180

  Fly   198 KYAVLYNHEKLSAEQLQRALMLPSIETQFEEPDPLRKIETWNYTNMNSIMYVPDGVEYTEEERVQ 262
            ::|.||..|:...::.:..|.|||.|.|..|... ..:|||.|...||:||.|:||  .:||  |
  Rat   181 RHAWLYQAEEEFEKRQKDNLELPSAEHQAIESSQ-AGVETWKYKAKNSLMYYPEGV--PDEE--Q 240

  Fly   263 LAERKQSIQHNATR-LPD-----------------EAKHRE----MDTKKLNDEVPQNGAGGATA 305
            |.::.:.|.|..|| |.|                 .|:|::    .|.|:|   :||.       
  Rat   241 LFKKPRQIVHKNTRFLRDPFSQALSRSQLQQAAALNAQHKQGKVGPDGKEL---IPQE------- 295

  Fly   306 TPKVRGFDLLRSPSPRPGEAFSPIMTWGEIDGTPFRLDGGDTP-LRPTQGPSFRINENSRRENIA 369
            :|:|.||..:.:|||.||...||:|||||::.||.|::|.::| :..|.||:|:|.|..|||.:.
  Rat   296 SPRVGGFGFVATPSPAPGMNESPLMTWGEVENTPLRVEGSESPYVDRTPGPTFKILEPGRRERLG 360

  Fly   370 IALAERVSERMRNQKQMALDTARRNIGSPLIRTNMERLASMSPAAQLLATGKLGIRGTPRLRHTP 434
            :.:|...:.:.|.:||.||.....|:.|   .|......:||||.|.|.:            .|.
  Rat   361 LKMANEAAAKNRAKKQEALRRVTENLAS---LTPKGLSPAMSPALQRLVS------------RTA 410

  Fly   435 SPMSGR--KRKVTPGVVRSTNTPILGEPKPKQQAKISTPAKN------VTIDTGSTLTDDLLKIP 491
            |..:.|  :...||...|||:   |..|....|...||||..      :|.|..| :||:||::|
  Rat   411 SKYTDRALRASYTPSPARSTH---LKTPAGGPQTPTSTPAPGSATRTPLTQDPAS-ITDNLLQLP 471

  Fly   492 TKRRTAADFF 501
            . ||.|:|||
  Rat   472 A-RRKASDFF 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Es2NP_572480.1 Es2 47..417 CDD:286794 146/401 (36%)
Ess2NP_001012490.1 Es2 37..405 CDD:286794 146/401 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C164722578
eggNOG 1 0.900 E1_KOG2627
Hieranoid 1 1.000
Homologene 1 1.000 H11184
Inparanoid 1 1.050 230 1.000 Inparanoid score I3314
OMA 1 1.010
OrthoDB 1 1.010 D1378245at2759
OrthoFinder 1 1.000 FOG0005018
OrthoInspector 1 1.000 T1086127
orthoMCL 1 0.900 OOG5_129811
Panther 1 1.100 LDO PTHR12940
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.